DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zip48C and slc39a6

DIOPT Version :9

Sequence 1:NP_610712.1 Gene:Zip48C / 36273 FlyBaseID:FBgn0033665 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_002935324.1 Gene:slc39a6 / 100487349 XenbaseID:XB-GENE-986480 Length:660 Species:Xenopus tropicalis


Alignment Length:172 Identity:41/172 - (23%)
Similarity:77/172 - (44%) Gaps:23/172 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 EEQQRAEDALSQWKRIMLLVVAITVHNIPEGLAVGVSFGAIGSTNSSTFESARNLAIGIGIQNFP 242
            ||.:.|..|...|    ::::...:||..:|||:|.:|       :....|..:.::.:.....|
 Frog   490 EELKDAGIATLAW----MVIMGDGLHNFGDGLAIGAAF-------TEGLSSGLSTSVAVFCHELP 543

  Fly   243 EGLAVSLPLHAAGFSVKRALWYGQLSGMVEPIFGVLGAVAVTFANLILPYALSFAAGAMIYIVSD 307
            ..|.....|..:|.:|::|:.|..||.|:..:..:.|.:...:|..:..:..:..||..:|:...
 Frog   544 HELGDFAVLLKSGMTVRQAVMYNGLSAMLAYLGMITGILIGHYAENVSMWIFALTAGLFMYVAFV 608

  Fly   308 DILPEA---HASGNGTIATW--------GTVSGFLIMMCLEV 338
            |::||.   .||.:| .:.|        |.:.||.||:.:.|
 Frog   609 DMVPEMLHNDASDHG-CSRWGYFLLQNAGILLGFFIMLVISV 649

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zip48CNP_610712.1 ZupT 23..340 CDD:223505 41/172 (24%)
slc39a6XP_002935324.1 Zip 236..647 CDD:308248 40/168 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.