DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1alpha1 and GCD11

DIOPT Version :9

Sequence 1:NP_001286321.1 Gene:eEF1alpha1 / 36271 FlyBaseID:FBgn0284245 Length:463 Species:Drosophila melanogaster
Sequence 2:NP_010942.1 Gene:GCD11 / 856746 SGDID:S000000827 Length:527 Species:Saccharomyces cerevisiae


Alignment Length:420 Identity:91/420 - (21%)
Similarity:135/420 - (32%) Gaps:157/420 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGIT 72
            |||..||||..||||    ::....|:  :|:                      :.|.|.||.||
Yeast   101 INIGTIGHVAHGKST----VVRAISGV--QTV----------------------RFKDELERNIT 137

  Fly    73 IDIALWKFETAKYY----------------------------------------VTIIDAPGHRD 97
            |.:.   :..||.|                                        |:.:|.|||..
Yeast   138 IKLG---YANAKIYKCQEPTCPEPDCYRSFKSDKEISPKCQRPGCPGRYKLVRHVSFVDCPGHDI 199

  Fly    98 FIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSSEPPY 162
            .:..|::|.:..|.|:|::|....      ....||.||......:.:|.:|:..||:|...   
Yeast   200 LMSTMLSGAAVMDAALLLIAGNES------CPQPQTSEHLAAIEIMKLKHVIILQNKVDLMR--- 255

  Fly   163 SEARYEEIKKEVSSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTNMPWFKGWKVERKEGNADGKT 227
             |....|.:|.:..:|:  |........||||                            |..|.
Yeast   256 -EESALEHQKSILKFIR--GTIADGAPIVPIS----------------------------AQLKY 289

  Fly   228 LIDALDAILP---PARPTD-----KALRLPLQDVYKIGG-----IGTVPVGRVETGVLKPGTVVV 279
            .|||::..:.   |..|.|     :.:.:...||.|.|.     .|.|..|.:..||.|.|..:.
Yeast   290 NIDAVNEFIVKTIPVPPRDFMISPRLIVIRSFDVNKPGAEIEDLKGGVAGGSILNGVFKLGDEIE 354

  Fly   280 FAPANITTEVK-------------SVEMHHEALQEAVPGDNVGFNVKNVSVKELRRGYVAGDSKA 331
            ..|..:|.:.|             |:......|:.||||                 |.:...:|.
Yeast   355 IRPGIVTKDDKGKIQCKPIFSNIVSLFAEQNDLKFAVPG-----------------GLIGVGTKV 402

  Fly   332 NPPKGAAD-FTAQVIVLNHPGQIANGYTPV 360
            :|....|| ...||:  ...|.:.|.||.:
Yeast   403 DPTLCRADRLVGQVV--GAKGHLPNIYTDI 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1alpha1NP_001286321.1 PTZ00141 1..457 CDD:185474 91/420 (22%)
GCD11NP_010942.1 PTZ00327 74..524 CDD:240362 91/420 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.