DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1alpha1 and IFM1

DIOPT Version :9

Sequence 1:NP_001286321.1 Gene:eEF1alpha1 / 36271 FlyBaseID:FBgn0284245 Length:463 Species:Drosophila melanogaster
Sequence 2:NP_014619.1 Gene:IFM1 / 854135 SGDID:S000005383 Length:676 Species:Saccharomyces cerevisiae


Alignment Length:315 Identity:71/315 - (22%)
Similarity:115/315 - (36%) Gaps:121/315 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITID 74
            :.::||||.||:|...:|            .|....|||.|                   |||..
Yeast   148 VTIMGHVDHGKTTIIDYL------------RKSSVVAQEHG-------------------GITQH 181

  Fly    75 IALWKFETAK--YYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHA 137
            |..::....|  ..:|.:|.|||..|:|....|.:..|..||:|:.                |.:
Yeast   182 IGAFQITAPKSGKKITFLDTPGHAAFLKMRERGANITDIIVLVVSV----------------EDS 230

  Fly   138 LLAFTL-GVK-------QLIVGVNKMDSSEPPYSEARYEEIKKEVSSYI------KKIGYNPAAV 188
            |:..|| .:|       ::|:.:.|:|  ..|..:.|.::|:|.::..|      :|||   ..|
Yeast   231 LMPQTLEAIKHAKNSGNEMIIAITKID--RIPQPKEREKKIEKVINDLIVQGIPVEKIG---GDV 290

  Fly   189 AFVPISGWHGDNM--LEPS------------TNMP--WFKGWKVERKEGNADGKTLIDALDAILP 237
            ..:|||...|:||  ||.|            .|.|  ..:||.:|.                   
Yeast   291 QVIPISAKTGENMDLLEESIVLLSEVMDIRAENSPKTIAEGWIIES------------------- 336

  Fly   238 PARPTDKALRLPLQDVYKIGGIGTVPVGRVETGVLKPGTVVVFAPANITTEVKSV 292
                         |...::|.:.||   .|:.|.|:.|.:::.  .|...::|::
Yeast   337 -------------QVKKQVGNVATV---LVKKGTLQKGKILIC--GNTFCKIKNL 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1alpha1NP_001286321.1 PTZ00141 1..457 CDD:185474 71/315 (23%)
IFM1NP_014619.1 IF2_N 63..114 CDD:398434
InfB 141..676 CDD:223606 71/315 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.