DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1alpha1 and mIF2

DIOPT Version :9

Sequence 1:NP_001286321.1 Gene:eEF1alpha1 / 36271 FlyBaseID:FBgn0284245 Length:463 Species:Drosophila melanogaster
Sequence 2:NP_651621.2 Gene:mIF2 / 43382 FlyBaseID:FBgn0039588 Length:696 Species:Drosophila melanogaster


Alignment Length:406 Identity:98/406 - (24%)
Similarity:147/406 - (36%) Gaps:136/406 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IVVIGHVDSGKSTTTGHL------IYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 68
            :.|:||||.||:|....|      ..:.|||           .|.:|      |:.:.....|| 
  Fly   165 VTVMGHVDHGKTTLLDSLRGADVAAGEAGGI-----------TQHIG------AFTVTLENGER- 211

  Fly    69 RGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQT 133
                              ||.:|.|||..|......|....|..||:|||     |.|:.  .||
  Fly   212 ------------------VTFLDTPGHAAFSAMRARGAVATDIIVLVVAA-----EDGVM--AQT 251

  Fly   134 REHALLAFTLGVKQLIVGVNKMDSSEPPYSEARYEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 198
            ||...||....| .:||.:||:|.     .||..|:.|:|::.....:..:...|..:|||...|
  Fly   252 REVIQLAKEAQV-PIIVALNKIDK-----PEANIEKSKRELAQMGLALEEHGGDVQVIPISALKG 310

  Fly   199 DN---MLEPSTNMPWFKGWKVERKEGNADGKTLIDAL--DAILPPARPTDKALRLPLQDVYKIGG 258
            .|   :.|..:......|.|       ||...|::.:  ::...|.|                |.
  Fly   311 TNLELLAEAVSTQATLMGLK-------ADPTGLVEGIVVESKTDPRR----------------GK 352

  Fly   259 IGTVPVGRVETGVLKPGTVVVFAPANITTEVKSVEMHH-EALQEAVPGDNVGFNVKNVSVKELRR 322
            :.|..|.|   |.|:.|:|::...|:  .:|:.:..|: :.|.||.||.    .|:.:..:||. 
  Fly   353 LSTAIVSR---GTLRKGSVLLSGLAH--AKVRGLFDHNGQPLSEAPPGT----PVEILGWRELP- 407

  Fly   323 GYVAGDSKANPPKGAADFTAQVIVLNHPGQIANGYTPVLDCHT---AHIACKFAE---IKEKVDR 381
              :|||.                              :|:..|   ||...|:.|   .:||::.
  Fly   408 --LAGDL------------------------------ILEVETEKKAHAVLKYREHESQQEKIES 440

  Fly   382 RSG----KTTEENPKF 393
            .|.    |..|...|:
  Fly   441 SSDEIRKKEEEHQAKY 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1alpha1NP_001286321.1 PTZ00141 1..457 CDD:185474 98/406 (24%)
mIF2NP_651621.2 InfB 158..689 CDD:223606 98/406 (24%)
IF2_eIF5B 163..327 CDD:206674 57/210 (27%)
IF2_mtIF2_II 336..431 CDD:293903 30/152 (20%)
IF-2 482..575 CDD:288813
mtIF2_IVc 593..680 CDD:293893
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464631
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.