DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1alpha1 and eEFSec

DIOPT Version :9

Sequence 1:NP_001286321.1 Gene:eEF1alpha1 / 36271 FlyBaseID:FBgn0284245 Length:463 Species:Drosophila melanogaster
Sequence 2:NP_611584.1 Gene:eEFSec / 37444 FlyBaseID:FBgn0034627 Length:511 Species:Drosophila melanogaster


Alignment Length:340 Identity:82/340 - (24%)
Similarity:130/340 - (38%) Gaps:71/340 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERG 70
            |:.||.::|||||||:|....|                        .|.......||.....|||
  Fly     3 INFNIGLLGHVDSGKTTLAKAL------------------------SSISSTAAFDKNPQSVERG 43

  Fly    71 ITIDIA-----------LWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 124
            ||:|:.           |.:.|..::  |.:|.|||...|:.:|.|....|..:|:|.|..|   
  Fly    44 ITLDLGFSGLLVDAPAHLPQGEQLQF--TFVDCPGHASLIRTIIGGAQIIDLMLLVVDAQKG--- 103

  Fly   125 AGISKNGQTREHALLAFTLGVKQLIVGVNKMDSSEPPYSEARYEEIKKEVSSYIKKIGYNPAAVA 189
                |..||.| .|:...|..|:|||.:||:|........::.|:::..::..::...:. ..|.
  Fly   104 ----KQTQTAE-CLIIGELLQKKLIVVINKIDVYPENQRASKLEKLRLRLAKTLEATTFG-GQVP 162

  Fly   190 FVPISGWHGDNMLEPSTNMPWFKGWKVERKEGNADGKTLIDAL-DAILPPARPTDKALRLPLQDV 253
            ...:|...|.::.|                        |.:.| :|...|.|.....|.:.:...
  Fly   163 ICAVSALQGTHIAE------------------------LREVLREAYFQPQRNLADPLFMYVDHC 203

  Fly   254 YKIGGIGTVPVGRVETGVLKPGTVVVFAPANITTEVKSVEMHHEALQEAVPGDNVGFNVKNVSVK 318
            :.|.|.|||..|.:..|.::...|:.........:|||::|..:.:..|..||.:|..|...:.|
  Fly   204 FGIKGQGTVCTGTLLQGKVQVNNVIELPALGEQRKVKSIQMFRKNVTSASMGDRIGLCVTQFNAK 268

  Fly   319 ELRRGYVAGDSKANP 333
            .|.||.:.......|
  Fly   269 LLERGIITQPGYLKP 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1alpha1NP_001286321.1 PTZ00141 1..457 CDD:185474 82/340 (24%)
eEFSecNP_611584.1 SelB_euk 5..192 CDD:206676 58/245 (24%)
SelB 6..467 CDD:225815 81/337 (24%)
SelB_II 196..278 CDD:293897 22/81 (27%)
eSelB_III 283..396 CDD:294009 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464619
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.