Sequence 1: | NP_001286321.1 | Gene: | eEF1alpha1 / 36271 | FlyBaseID: | FBgn0284245 | Length: | 463 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001369996.1 | Gene: | eef-2 / 172743 | WormBaseID: | WBGene00001167 | Length: | 852 | Species: | Caenorhabditis elegans |
Alignment Length: | 262 | Identity: | 60/262 - (22%) |
---|---|---|---|
Similarity: | 93/262 - (35%) | Gaps: | 94/262 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITI 73
Fly 74 D---IALW---------------KFETAK----------YYVTIIDAPGHRDFIKNMITGTSQAD 110
Fly 111 CAVLIVAAGTGEFEAGISKNGQT------------------REHALLAFTLGVKQLIVGVNKMDS 157
Fly 158 SEPPYSEARYEEIKKEVSSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTNMPWF----KGWKVER 218
Fly 219 KE 220 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
eEF1alpha1 | NP_001286321.1 | PTZ00141 | 1..457 | CDD:185474 | 60/262 (23%) |
eef-2 | NP_001369996.1 | PTZ00416 | 1..852 | CDD:240409 | 60/262 (23%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |