DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1alpha1 and eef-2

DIOPT Version :9

Sequence 1:NP_001286321.1 Gene:eEF1alpha1 / 36271 FlyBaseID:FBgn0284245 Length:463 Species:Drosophila melanogaster
Sequence 2:NP_001369996.1 Gene:eef-2 / 172743 WormBaseID:WBGene00001167 Length:852 Species:Caenorhabditis elegans


Alignment Length:262 Identity:60/262 - (22%)
Similarity:93/262 - (35%) Gaps:94/262 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITI 73
            |:.||.|||.||||.|..|:.|.|.|          ...:.|:..|     .|..|.|:||.|||
 Worm    21 NMSVIAHVDHGKSTLTDSLVSKAGII----------AGSKAGETRF-----TDTRKDEQERCITI 70

  Fly    74 D---IALW---------------KFETAK----------YYVTIIDAPGHRDFIKNMITGTSQAD 110
            .   |:|:               :|||.:          :.:.:||:|||.||...:.......|
 Worm    71 KSTAISLFFELEKKDLEFVKGENQFETVEVDGKKEKYNGFLINLIDSPGHVDFSSEVTAALRVTD 135

  Fly   111 CAVLIVAAGTGEFEAGISKNGQT------------------REHALLAFTLGVKQLIVGVNKMDS 157
            .|:::|     :..:|:....:|                  .:.|||...||.::|.        
 Worm   136 GALVVV-----DCVSGVCVQTETVLRQAIAERIKPVLFMNKMDRALLELQLGAEELF-------- 187

  Fly   158 SEPPYSEARYEEIKKEVSSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTNMPWF----KGWKVER 218
                   ..::.|.:.::..|...|.:         .|..|..|::||.....|    .||....
 Worm   188 -------QTFQRIVENINVIIATYGDD---------DGPMGPIMVDPSIGNVGFGSGLHGWAFTL 236

  Fly   219 KE 220
            |:
 Worm   237 KQ 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1alpha1NP_001286321.1 PTZ00141 1..457 CDD:185474 60/262 (23%)
eef-2NP_001369996.1 PTZ00416 1..852 CDD:240409 60/262 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.