DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1alpha1 and adam28.1

DIOPT Version :9

Sequence 1:NP_001286321.1 Gene:eEF1alpha1 / 36271 FlyBaseID:FBgn0284245 Length:463 Species:Drosophila melanogaster
Sequence 2:NP_001233133.1 Gene:adam28.1 / 100488450 XenbaseID:XB-GENE-982024 Length:780 Species:Xenopus tropicalis


Alignment Length:75 Identity:17/75 - (22%)
Similarity:29/75 - (38%) Gaps:20/75 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   302 AVPGDNVGFNVKNVSV-----------------KELRRGYV---AGDSKANPPKGAADFTAQVIV 346
            :||.::..|||....|                 |:::.|.:   .|.|:.:.....|:|:....|
 Frog   513 SVPSEDSCFNVNTRGVDYGYCTMAGATYVPCKPKDVKCGMLFCYGGSSQPSIYAAVAEFSRCRAV 577

  Fly   347 LNHPGQIANG 356
            |...|.:.||
 Frog   578 LAQGGMVQNG 587

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1alpha1NP_001286321.1 PTZ00141 1..457 CDD:185474 17/75 (23%)
adam28.1NP_001233133.1 Pep_M12B_propep 30..150 CDD:366707
ZnMc_adamalysin_II_like 192..385 CDD:239797
Disintegrin 405..477 CDD:365943
ACR 482..601 CDD:214743 17/75 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 438 1.000 Domainoid score I548
eggNOG 1 0.900 - - E1_COG5256
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 814 1.000 Inparanoid score I470
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000314
OrthoInspector 1 1.000 - - mtm9332
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X149
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.910

Return to query results.
Submit another query.