powered by:
Protein Alignment eEF1alpha1 and adam28.1
DIOPT Version :9
Sequence 1: | NP_001286321.1 |
Gene: | eEF1alpha1 / 36271 |
FlyBaseID: | FBgn0284245 |
Length: | 463 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001233133.1 |
Gene: | adam28.1 / 100488450 |
XenbaseID: | XB-GENE-982024 |
Length: | 780 |
Species: | Xenopus tropicalis |
Alignment Length: | 75 |
Identity: | 17/75 - (22%) |
Similarity: | 29/75 - (38%) |
Gaps: | 20/75 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 302 AVPGDNVGFNVKNVSV-----------------KELRRGYV---AGDSKANPPKGAADFTAQVIV 346
:||.::..|||....| |:::.|.: .|.|:.:.....|:|:....|
Frog 513 SVPSEDSCFNVNTRGVDYGYCTMAGATYVPCKPKDVKCGMLFCYGGSSQPSIYAAVAEFSRCRAV 577
Fly 347 LNHPGQIANG 356
|...|.:.||
Frog 578 LAQGGMVQNG 587
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
438 |
1.000 |
Domainoid score |
I548 |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5256 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
814 |
1.000 |
Inparanoid score |
I470 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000314 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
mtm9332 |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X149 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
7 | 6.910 |
|
Return to query results.
Submit another query.