DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ERp60 and MPD1

DIOPT Version :9

Sequence 1:NP_725084.2 Gene:ERp60 / 36270 FlyBaseID:FBgn0033663 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_014931.3 Gene:MPD1 / 854462 SGDID:S000005814 Length:318 Species:Saccharomyces cerevisiae


Alignment Length:317 Identity:78/317 - (24%)
Similarity:136/317 - (42%) Gaps:81/317 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLGFIAISSGAEQD-------VLELGDDDFATTL-KQHETTLVMFYAPWCGHCKRLKPEYAKAA 65
            ||||...::....|:       :.||....|...: ..:.|:||.||||||||||:|...:.|||
Yeast     9 LLLGLFIMNEVKAQNFYDSDPHISELTPKSFDKAIHNTNYTSLVEFYAPWCGHCKKLSSTFRKAA 73

  Fly    66 EIVKDDDPPIKLAKVDC-TEAGKETCSKYSVSGYPTLKIFRQDEV-----------------SQD 112
               |..|..:::|.|:| ....|..|:||.|:|:|||.:||..::                 ::.
Yeast    74 ---KRLDGVVQVAAVNCDLNKNKALCAKYDVNGFPTLMVFRPPKIDLSKPIDNAKKSFSAHANEV 135

  Fly   113 YNGPR--------EASGIAKYMR--AQVGPASKTVRTVAELKKFLDTKDTTL------------- 154
            |:|.|        ..|.|..|::  .::......:|...:|...|.:|...:             
Yeast   136 YSGARTLAPIVDFSLSRIRSYVKKFVRIDTLGSLLRKSPKLSVVLFSKQDKISPVYKSIALDWLG 200

  Fly   155 -FGYFSDSDSKLAKI--FLKFADKNREKYRFGHSSEKEVLDKQGETDKIVLIRAPHLSNKFESSS 216
             |.::|.|:.||.::  .....:|..|.:::    .::|:.:|.::||..|:       .|::..
Yeast   201 KFDFYSISNKKLKQLTDMNPTYEKTPEIFKY----LQKVIPEQRQSDKSKLV-------VFDADK 254

  Fly   217 IKF---EGSS--ESDLSTFVKENFHGLVGHRTQDSVKDFQNPLITAYYSVDYQKNPK 268
            .||   ||:|  ::|:|.|:::.|          |:...:.|.......:.|.|..|
Yeast   255 DKFWEYEGNSINKNDISKFLRDTF----------SITPNEGPFSRRSEYIAYLKTGK 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ERp60NP_725084.2 ER_PDI_fam 23..479 CDD:273457 73/303 (24%)
PDI_a_PDIR 23..126 CDD:239295 41/136 (30%)
PDI_b_ERp57 133..235 CDD:239367 25/122 (20%)
PDI_b'_ERp72_ERp57 239..345 CDD:239371 5/30 (17%)
PDI_a_PDI_a'_C 365..467 CDD:239293
MPD1NP_014931.3 ER_PDI_fam 30..>275 CDD:273457 67/258 (26%)
PDI_a_MPD1_like 30..150 CDD:239300 39/122 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.