DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment ERp60 and AT3G62510

DIOPT Version :9

Sequence 1:	NP_725084.2	Gene:	ERp60 / 36270	FlyBaseID:	FBgn0033663	Length:	489	Species:	Drosophila melanogaster
Sequence 2:	NP_001327881.1	Gene:	AT3G62510 / 825425	AraportID:	AT3G62510	Length:	113	Species:	Arabidopsis thaliana

Alignment Length:	48	Identity:	16/48 - (33%)
Similarity:	29/48 - (60%)	Gaps:	0/48 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   331 EFSVENLQDFVEKLLANELEPYIKSEPIPESNDAPVKVAVAKNFDDLV 378
            |..|:.::.:|:.....:...:..|:|||..|:.|||:.||::.||:|
plant    27 EVEVDQIESWVKDFQDGKAAVHKNSQPIPAENNEPVKLVVAESLDDIV 74

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
ERp60	NP_725084.2	ER_PDI_fam	23..479	CDD:273457	16/48 (33%)
		PDI_a_PDIR	23..126	CDD:239295
		PDI_b_ERp57	133..235	CDD:239367
		PDI_b'_ERp72_ERp57	239..345	CDD:239371	3/13 (23%)
		PDI_a_PDI_a'_C	365..467	CDD:239293	8/14 (57%)
AT3G62510	NP_001327881.1	None
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0190
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D462118at2759
OrthoFinder	1	1.000	-	-		FOG0000292
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	3	2.910