DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ERp60 and TXNDC5

DIOPT Version :9

Sequence 1:NP_725084.2 Gene:ERp60 / 36270 FlyBaseID:FBgn0033663 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_110437.2 Gene:TXNDC5 / 81567 HGNCID:21073 Length:432 Species:Homo sapiens


Alignment Length:474 Identity:127/474 - (26%)
Similarity:193/474 - (40%) Gaps:153/474 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 QHETTLVMFYAPWCGHCKRLKPEYAKAAEIVKD-DDPPIKLAKVDCTEAGKETCSKYSVSGYPTL 101
            |.....|||:|||||||:||:|.:....:.... :|..:.:|||||| |..:.||...|.|||||
Human    76 QSAAHFVMFFAPWCGHCQRLQPTWNDLGDKYNSMEDAKVYVAKVDCT-AHSDVCSAQGVRGYPTL 139

  Fly   102 KIFRQDEVSQDYNGPREASGIAKYM-----------RAQVGPASKTVRTVAELKKFLDTKDTTLF 155
            |:|:..:.:..|.|||:...:..:|           ..:|.|.|     ..|||:.|.....:.|
Human   140 KLFKPGQEAVKYQGPRDFQTLENWMLQTLNEEPVTPEPEVEPPS-----APELKQGLYELSASNF 199

  Fly   156 GYFSDSDSKLAKIFLKFADKNREKYRFGHSSEKEVLDKQGETDKIVLIRAPHLSNKFESSSIKFE 220
            ...........|.|..:.         ||...                    |:..:|..::..|
Human   200 ELHVAQGDHFIKFFAPWC---------GHCKA--------------------LAPTWEQLALGLE 235

  Fly   221 GSSESDLSTFVKENFHGLVGHRTQDSVKDFQNPLITAYYSVDYQKNPKGTNYWRNRVLKVAKEFV 285
            .|                      ::||                                    :
Human   236 HS----------------------ETVK------------------------------------I 242

  Fly   286 GQINFAIASKDDFQH-EL---NEY-GYDFVGDKPVVL-ARDEKNL-KYALKDEFSVENLQDFVEK 343
            |::       |..|| ||   |:. ||      |.:| .||.|.: :|  |.:..:|:|:::||.
Human   243 GKV-------DCTQHYELCSGNQVRGY------PTLLWFRDGKKVDQY--KGKRDLESLREYVES 292

  Fly   344 LL------ANEL-----EPYIKSEPIPESNDAPVKVAVAKNFDDLVINNGKDTLIEFYAPWCGHC 397
            .|      |.|.     .|.:.:|  ||::...|......||||.:...  .|.|:|||||||||
Human   293 QLQRTETGATETVTPSEAPVLAAE--PEADKGTVLALTENNFDDTIAEG--ITFIKFYAPWCGHC 353

  Fly   398 KKLSPIYEELAEKLQDE-----DVAIVKMDATA-NDVPPEFNVRGFPTLFWLPKDAKNKPVSYNG 456
            |.|:|.:|||::|   |     .|.|.::|.|| .::..:::|||:|||. |.:..| |...::|
Human   354 KTLAPTWEELSKK---EFPGLAGVKIAEVDCTAERNICSKYSVRGYPTLL-LFRGGK-KVSEHSG 413

  Fly   457 GREVDDFLKYIAKEATTEL 475
            ||::|...:::..:|..||
Human   414 GRDLDSLHRFVLSQAKDEL 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ERp60NP_725084.2 ER_PDI_fam 23..479 CDD:273457 127/474 (27%)
PDI_a_PDIR 23..126 CDD:239295 36/88 (41%)
PDI_b_ERp57 133..235 CDD:239367 14/101 (14%)
PDI_b'_ERp72_ERp57 239..345 CDD:239371 22/112 (20%)
PDI_a_PDI_a'_C 365..467 CDD:239293 42/107 (39%)
TXNDC5NP_110437.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..63
PDI_a_ERp46 61..164 CDD:239303 36/88 (41%)
ER_PDI_fam 66..432 CDD:273457 125/472 (26%)
PDI_a_ERp46 190..290 CDD:239303 30/201 (15%)
PDI_a_ERp46 323..424 CDD:239303 42/107 (39%)
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 429..432 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.