DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ERp60 and TMX1

DIOPT Version :9

Sequence 1:NP_725084.2 Gene:ERp60 / 36270 FlyBaseID:FBgn0033663 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_110382.3 Gene:TMX1 / 81542 HGNCID:15487 Length:280 Species:Homo sapiens


Alignment Length:104 Identity:36/104 - (34%)
Similarity:56/104 - (53%) Gaps:7/104 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   366 VKVAVAKNFDDLVINNGKDTLIEFYAPWCGHCKKLSPIYEELAEKLQDEDVAIVKMDATAN-DVP 429
            |:|...:|:.:|:..   |.:||||||||..|:.|.|.:|..||..:|.:|.|.|:|.|.. .:.
Human    31 VRVITDENWRELLEG---DWMIEFYAPWCPACQNLQPEWESFAEWGEDLEVNIAKVDVTEQPGLS 92

  Fly   430 PEFNVRGFPTLFWLPKDAKNKPVSYNGGREVDDFLKYIA 468
            ..|.:...||::.. ||.:.:  .|.|.|...||:.:|:
Human    93 GRFIITALPTIYHC-KDGEFR--RYQGPRTKKDFINFIS 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ERp60NP_725084.2 ER_PDI_fam 23..479 CDD:273457 36/104 (35%)
PDI_a_PDIR 23..126 CDD:239295
PDI_b_ERp57 133..235 CDD:239367
PDI_b'_ERp72_ERp57 239..345 CDD:239371
PDI_a_PDI_a'_C 365..467 CDD:239293 35/101 (35%)
TMX1NP_110382.3 PDI_a_TMX 29..129 CDD:239292 36/104 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 218..280
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156387
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.