DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ERp60 and tmx4

DIOPT Version :9

Sequence 1:NP_725084.2 Gene:ERp60 / 36270 FlyBaseID:FBgn0033663 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_001025330.1 Gene:tmx4 / 792311 ZFINID:ZDB-GENE-050706-155 Length:277 Species:Danio rerio


Alignment Length:116 Identity:35/116 - (30%)
Similarity:53/116 - (45%) Gaps:10/116 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   363 DAPVKVAVAKNFDDLVINNGKDTLIEFYAPWCGHCKKLSPIYEELAEKLQDEDVAIVKMDATAN- 426
            ||...|.||.....|::..  :.:|:||||||..|:.|...:|.|..:.....:::.::|.|.. 
Zfish    27 DASNVVTVADANWTLILQG--EWMIKFYAPWCPACQHLQADWENLGRQSDSLGISVGRVDVTQQP 89

  Fly   427 DVPPEFNVRGFPTLFWLPKDAKNKPV-SYNGGREVDDFLKYIA--KEATTE 474
            .:...|.|...||:|    .|||... .|...|.::|...|:.  |.||.|
Zfish    90 GLSGRFLVTTLPTIF----HAKNGDFRKYVSSRTIEDIQAYVVHRKWATVE 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ERp60NP_725084.2 ER_PDI_fam 23..479 CDD:273457 35/116 (30%)
PDI_a_PDIR 23..126 CDD:239295
PDI_b_ERp57 133..235 CDD:239367
PDI_b'_ERp72_ERp57 239..345 CDD:239371
PDI_a_PDI_a'_C 365..467 CDD:239293 28/103 (27%)
tmx4NP_001025330.1 Thioredoxin_like 29..129 CDD:294274 29/105 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170591999
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.