DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ERp60 and Tmx1

DIOPT Version :9

Sequence 1:NP_725084.2 Gene:ERp60 / 36270 FlyBaseID:FBgn0033663 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_082615.1 Gene:Tmx1 / 72736 MGIID:1919986 Length:278 Species:Mus musculus


Alignment Length:278 Identity:61/278 - (21%)
Similarity:117/278 - (42%) Gaps:68/278 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VLLLGFIAISSGAEQDVLELGDDDFATTLKQHETTLVMFYAPWCGHCKRLKPEYAKAAEIVKDDD 72
            ||||..:..:.|...:|..|.|::: |:|.:.| .::.||||||..|:.|:||:...||  ..:|
Mouse    15 VLLLWAVPGAHGRRNNVRVLTDENW-TSLLEGE-WMIEFYAPWCPACQNLQPEWESFAE--WGED 75

  Fly    73 PPIKLAKVDCTEAGKET--CSKYSVSGYPTLKIFRQDEVSQDYNGPREASGIAKY---------- 125
            ..:|:||||.||   :|  ..::.::..|::...:..|..: |.|||.......:          
Mouse    76 LEVKVAKVDVTE---QTGLSGRFIITALPSIYHCKDGEFRR-YVGPRTKKDFINFVSDKEWKNIE 136

  Fly   126 -MRAQVGPASKTVRTVA---ELKKFLDTKD---------------------TTLFG--------Y 157
             :.:..||:|..:..::   :|..::.|..                     |.|.|        :
Mouse   137 PISSWFGPSSVLMTMMSALFQLSVYIRTSHSYFVHDLGIPAWGSYLVFAFATVLSGLLLGLCMIF 201

  Fly   158 FSD--SDSKLAKIFLKFADKNREKYRFGHSSEKEVLDKQGETDKIVLIRAPHLSNKFESSSIKFE 220
            .:|  ..||..|...::|.|...::    |...:.::::.|.|:         .:..|..:...|
Mouse   202 VADCLCPSKRRKPQQQYAKKTSPEF----SQPLKKVEEEQEADE---------EDVSEEEAEDRE 253

  Fly   221 GSSESDLSTFVKENFHGL 238
            |:|::...:.:::...||
Mouse   254 GASKATSQSSIRQRCVGL 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ERp60NP_725084.2 ER_PDI_fam 23..479 CDD:273457 56/263 (21%)
PDI_a_PDIR 23..126 CDD:239295 33/115 (29%)
PDI_b_ERp57 133..235 CDD:239367 19/135 (14%)
PDI_b'_ERp72_ERp57 239..345 CDD:239371 61/278 (22%)
PDI_a_PDI_a'_C 365..467 CDD:239293
Tmx1NP_082615.1 PDI_a_TMX 30..129 CDD:239292 33/106 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 217..278 11/68 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846789
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.