DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ERp60 and TMX4

DIOPT Version :9

Sequence 1:NP_725084.2 Gene:ERp60 / 36270 FlyBaseID:FBgn0033663 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_066979.2 Gene:TMX4 / 56255 HGNCID:25237 Length:349 Species:Homo sapiens


Alignment Length:395 Identity:88/395 - (22%)
Similarity:132/395 - (33%) Gaps:129/395 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IAISSGAEQDVLELGDDDFATTLKQHETTLVM-------FYAPWCGHCKRLKPE---YAKAAEIV 68
            :|.::|.|:..|. .:......:.....||||       ||||||..|::...|   :||..||:
Human    21 VAATAGPEEAALP-PEQSRVQPMTASNWTLVMEGEWMLKFYAPWCPSCQQTDSEWEAFAKNGEIL 84

  Fly    69 KDDDPPIKLAKVD-CTEAGKETCSKYSVSGYPTLKIFRQDEVSQDYNGPREASGIAKY------- 125
            :     |.:.||| ..|.|  ...::.|:..|.. ...:|.:.:.|.||.....:..|       
Human    85 Q-----ISVGKVDVIQEPG--LSGRFFVTTLPAF-FHAKDGIFRRYRGPGIFEDLQNYILEKKWQ 141

  Fly   126 ----MRAQVGPASKTVRTVAELKKFLDTKDTTLFGYFSDSDSKLAKIFLKFADKNREKYRFGHSS 186
                :.....|||.|:..:|              |.||.|    .||:                 
Human   142 SVEPLTGWKSPASLTMSGMA--------------GLFSIS----GKIW----------------- 171

  Fly   187 EKEVLDKQGETDKIVLIRAPHLSNKFE--------SSSIKFEGSSESDLSTFVKENFHGLVGHRT 243
                                ||.|.|.        .|.:.|.      ::|.|...|.|||....
Human   172 --------------------HLHNYFTVTLGIPAWCSYVFFV------IATLVFGLFMGLVLVVI 210

  Fly   244 QDSVKDFQNPLITAYYSVDYQKNPKGTNYWRNRVLKVAKEFVGQINFAIASKDDFQHELN----- 303
            .:.   |..|| ..:.|...::|.:.....|...|:.|:|          .|||...|.|     
Human   211 SEC---FYVPL-PRHLSERSEQNRRSEEAHRAEQLQDAEE----------EKDDSNEEENKDSLV 261

  Fly   304 --EYGYDFVGDKPVVLARDEK-NLKYALKDEFSVENLQ-----DFV--EKLLANELEPYIKSEPI 358
              |...:.:||:......:|: ||...:.:|.|..|.|     |.|  |::...|.|..|..:|.
Human   262 DDEEEKEDLGDEDEAEEEEEEDNLAAGVDEERSEANDQGPPGEDGVTREEVEPEEAEEGISEQPC 326

  Fly   359 PESND 363
            |...:
Human   327 PADTE 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ERp60NP_725084.2 ER_PDI_fam 23..479 CDD:273457 85/386 (22%)
PDI_a_PDIR 23..126 CDD:239295 30/124 (24%)
PDI_b_ERp57 133..235 CDD:239367 18/109 (17%)
PDI_b'_ERp72_ERp57 239..345 CDD:239371 28/120 (23%)
PDI_a_PDI_a'_C 365..467 CDD:239293
TMX4NP_066979.2 PDI_a_TMX 37..137 CDD:239292 29/107 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 225..349 28/117 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156386
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.