DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ERp60 and txndc16

DIOPT Version :9

Sequence 1:NP_725084.2 Gene:ERp60 / 36270 FlyBaseID:FBgn0033663 Length:489 Species:Drosophila melanogaster
Sequence 2:XP_685017.4 Gene:txndc16 / 556973 ZFINID:ZDB-GENE-100712-1 Length:804 Species:Danio rerio


Alignment Length:272 Identity:65/272 - (23%)
Similarity:107/272 - (39%) Gaps:56/272 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 QDVLELGDDDFATTLKQHETTLVMFYAPWCGHCKRLKPEYAKAAEIVKDDDPPIKLAKVDCTEAG 86
            :.|.||..|.|.|.:||:|.|:|:||..|...|......|.:.||.|:|.: .::||.|||.| .
Zfish   386 EPVTELTADTFQTAIKQNEITVVLFYFKWDAVCMAFIQSYVEVAEAVEDVN-GVELAAVDCGE-W 448

  Fly    87 KETCSKYSVSGYPTLKIF-RQDEVSQDYNGPREASGIAKYMRAQVGPASKTVRTVAELKKFLD-- 148
            .:.|...:::.:||:.|: .:...:|.|.|......:.:::...:......:.:.||:..||:  
Zfish   449 TDICRDQNITSFPTVLIYCPKAAAAQPYRGMMGTKSLQRFILLSLVSTPVHLSSSAEVMSFLEGD 513

  Fly   149 -------TKDTTLFGYFS----------DSDSKLAK---IFLKFADKNREKYRFGHS-------- 185
                   .....:.|.||          :..::|.:   |...||.|...|:..|.|        
Zfish   514 LYRKYVYLTPVRVLGLFSSMQDMGVSSFEEAARLLRGETIIGLFAHKEAAKWVEGLSVNLPALLV 578

  Fly   186 SEKEVLDKQG-------ETDKIVLIRAPHLSNKFESSSIK---------------FEGSSESDLS 228
            |....|..|.       .||.:.||:...| .:|...:::               |.|..||..|
Zfish   579 SHGPALPHQVFSLPSSLATDHVKLIQRVEL-ERFPELTVENLPWYLELEKPLLLLFIGKEESTES 642

  Fly   229 TFVKENFHGLVG 240
            |......:.|:|
Zfish   643 TRSLAEINQLLG 654

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ERp60NP_725084.2 ER_PDI_fam 23..479 CDD:273457 65/271 (24%)
PDI_a_PDIR 23..126 CDD:239295 33/103 (32%)
PDI_b_ERp57 133..235 CDD:239367 30/153 (20%)
PDI_b'_ERp72_ERp57 239..345 CDD:239371 1/2 (50%)
PDI_a_PDI_a'_C 365..467 CDD:239293
txndc16XP_685017.4 PDI_a_family 389..489 CDD:239259 32/101 (32%)
Thioredoxin_6 530..722 CDD:290560 27/126 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.