Sequence 1: | NP_725084.2 | Gene: | ERp60 / 36270 | FlyBaseID: | FBgn0033663 | Length: | 489 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_685017.4 | Gene: | txndc16 / 556973 | ZFINID: | ZDB-GENE-100712-1 | Length: | 804 | Species: | Danio rerio |
Alignment Length: | 272 | Identity: | 65/272 - (23%) |
---|---|---|---|
Similarity: | 107/272 - (39%) | Gaps: | 56/272 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 22 QDVLELGDDDFATTLKQHETTLVMFYAPWCGHCKRLKPEYAKAAEIVKDDDPPIKLAKVDCTEAG 86
Fly 87 KETCSKYSVSGYPTLKIF-RQDEVSQDYNGPREASGIAKYMRAQVGPASKTVRTVAELKKFLD-- 148
Fly 149 -------TKDTTLFGYFS----------DSDSKLAK---IFLKFADKNREKYRFGHS-------- 185
Fly 186 SEKEVLDKQG-------ETDKIVLIRAPHLSNKFESSSIK---------------FEGSSESDLS 228
Fly 229 TFVKENFHGLVG 240 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ERp60 | NP_725084.2 | ER_PDI_fam | 23..479 | CDD:273457 | 65/271 (24%) |
PDI_a_PDIR | 23..126 | CDD:239295 | 33/103 (32%) | ||
PDI_b_ERp57 | 133..235 | CDD:239367 | 30/153 (20%) | ||
PDI_b'_ERp72_ERp57 | 239..345 | CDD:239371 | 1/2 (50%) | ||
PDI_a_PDI_a'_C | 365..467 | CDD:239293 | |||
txndc16 | XP_685017.4 | PDI_a_family | 389..489 | CDD:239259 | 32/101 (32%) |
Thioredoxin_6 | 530..722 | CDD:290560 | 27/126 (21%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |