DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ERp60 and CG5554

DIOPT Version :9

Sequence 1:NP_725084.2 Gene:ERp60 / 36270 FlyBaseID:FBgn0033663 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_001286784.1 Gene:CG5554 / 37775 FlyBaseID:FBgn0034914 Length:330 Species:Drosophila melanogaster


Alignment Length:184 Identity:51/184 - (27%)
Similarity:88/184 - (47%) Gaps:18/184 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 AGVLLLGFIAISSGAEQDVLELG------DDDFATTLKQHETTLVMFYAPWCGHCKRLKPEYAKA 64
            |.:|||...|.|:.|.|..|:.|      |:|....:.|.| .::.|:||||..||.|.|.:.:.
  Fly    13 AALLLLAATAQSTAAAQSGLQPGGKLIELDEDNWHLMLQGE-WMIEFFAPWCPACKNLAPTWERF 76

  Fly    65 AEIVKDDDPPIKLAKVDCTEAGKETCSKYSVSGYPTLKIFRQDEVSQDYNGPREASGIAKYMRAQ 129
            |.:.|  |..:::||:|.| .......::.|:..||:...:..|..| |.|.|:...:..:::.|
  Fly    77 ARVAK--DVQVQVAKIDVT-TSPSLSGRFFVTALPTIYHVKDGEFRQ-YRGARDGDALLYFVKKQ 137

  Fly   130 VGPASKTVRTVAELKKFLDTKDTTLFGYF---SDSDSKLAKIFLKFADKNREKY 180
               ..:::..::..|| .||...::..||   |.:.....|:|..|..:.:|:|
  Fly   138 ---QWQSIEPLSAWKK-PDTTHMSVLSYFFKLSHTLKHTQKLFKDFNGRLQEEY 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ERp60NP_725084.2 ER_PDI_fam 23..479 CDD:273457 43/167 (26%)
PDI_a_PDIR 23..126 CDD:239295 30/108 (28%)
PDI_b_ERp57 133..235 CDD:239367 12/51 (24%)
PDI_b'_ERp72_ERp57 239..345 CDD:239371
PDI_a_PDI_a'_C 365..467 CDD:239293
CG5554NP_001286784.1 PDI_a_TMX 36..136 CDD:239292 28/104 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463719
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.