DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ERp60 and prtp

DIOPT Version :9

Sequence 1:NP_725084.2 Gene:ERp60 / 36270 FlyBaseID:FBgn0033663 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_001188583.1 Gene:prtp / 32124 FlyBaseID:FBgn0030329 Length:416 Species:Drosophila melanogaster


Alignment Length:504 Identity:120/504 - (23%)
Similarity:199/504 - (39%) Gaps:144/504 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LAGVLLLGFIAISSGAEQD---------VLELGDDDFATTLKQHETTLVMFYAPWCGHCKRLKPE 60
            :.|:||...:.|:..::::         .:||..:.|.|.: ......|.|:|||||||||::|.
  Fly    11 VCGLLLSPLLPITRASQEEDTGKQDKQFTVELDPETFDTAI-AGGNVFVKFFAPWCGHCKRIQPL 74

  Fly    61 YAKAAEIVKDDDPPIKLAKVDCTEAGKETCSKYSVSGYPTLKIFR-QDEVSQDYNGPREASGIAK 124
            :.:.|||:..|:|.:.:||||||: .:..|:.:.|:|||||::|: .:|.|..:.|.|:...|..
  Fly    75 WEQLAEIMNVDNPKVIIAKVDCTK-HQGLCATHQVTGYPTLRLFKLGEEESVKFKGTRDLPAITD 138

  Fly   125 YMRAQVGPASKTVRTVAELKKFLDTKDTTLFGYFSDSDSKLAKIFLKFADKNREKYRFGHSSEKE 189
            ::                                                 |:|           
  Fly   139 FI-------------------------------------------------NKE----------- 143

  Fly   190 VLDKQGETDKIVLIRAPHLSNKFESSSIKFEGSSESDLSTFVKENFHGLVGHRTQDSVKD-FQNP 253
                         :.||                :|:||....:|....|...:..|..:| |...
  Fly   144 -------------LSAP----------------AEADLGEVKREQVENLNIGKVVDLTEDTFAKH 179

  Fly   254 LITAYYSVDY---------QKNPKGTNYWRNRVLKVAKEFVGQINFAIASKDDFQHELNEYGYDF 309
            :.|..:.|.:         :..|.    |.:    :|||.:.:....|:..|..|.......::.
  Fly   180 VSTGNHFVKFFAPWCSHCQRLAPT----WED----LAKELIKEPTVTISKIDCTQFRSICQDFEV 236

  Fly   310 VGDKPVVLARDEKNL-KYALKDEFSVENLQDFVEKLLANELE--------PYIKSEPIPESNDA- 364
            .|...::...|.|.: ||:...:.|  .|:.:|||::...||        ..:..|.:....|| 
  Fly   237 KGYPTLLWIEDGKKIEKYSGARDLS--TLKTYVEKMVGVPLEKTAGEAGDEKVVIEEVAGEEDAA 299

  Fly   365 ----PVKVAVAKNFDDLVINNGKDTLIEFYAPWCGHCKKLSPIYEELAEKLQ--DEDVAIVKMDA 423
                |.::.....||..:...  ...|:|||||||||:||.|.:|:||.:..  ...|.|.|:|.
  Fly   300 KKLTPQQLTGEDEFDQAIAEG--VAFIKFYAPWCGHCQKLQPTWEQLATETHQAQSSVKIAKVDC 362

  Fly   424 TA---NDVPPEFNVRGFPTLFWLPKDAKNKPVSYNGGREVDDFLKYIAK 469
            ||   ..|..:..|.|:|||| |.|:.:.:. .|.|.|.:.:...|:.|
  Fly   363 TAPENKQVCIDQQVEGYPTLF-LYKNGQRQN-EYEGSRSLPELQAYLKK 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ERp60NP_725084.2 ER_PDI_fam 23..479 CDD:273457 116/486 (24%)
PDI_a_PDIR 23..126 CDD:239295 40/112 (36%)
PDI_b_ERp57 133..235 CDD:239367 8/101 (8%)
PDI_b'_ERp72_ERp57 239..345 CDD:239371 23/116 (20%)
PDI_a_PDI_a'_C 365..467 CDD:239293 37/106 (35%)
prtpNP_001188583.1 PDI_a_ERp46 38..140 CDD:239303 40/103 (39%)
ER_PDI_fam 39..409 CDD:273457 115/474 (24%)
PDI_a_ERp46 167..267 CDD:239303 20/109 (18%)
PDI_a_ERp46 303..407 CDD:239303 37/107 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463722
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.