DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ERp60 and Erp27

DIOPT Version :9

Sequence 1:NP_725084.2 Gene:ERp60 / 36270 FlyBaseID:FBgn0033663 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_001100095.1 Gene:Erp27 / 297698 RGDID:1565381 Length:272 Species:Rattus norvegicus


Alignment Length:284 Identity:64/284 - (22%)
Similarity:102/284 - (35%) Gaps:70/284 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 DEVSQDYNGPREASGIAKYMRAQVGPASKTVRTVAELKKFLDTKDTTLFGYFSDSDSKLAKIFLK 171
            :|.|:....|||...:...      ||  ||..:|       ..:..:.|:|.|.:..:..||..
  Rat    28 EETSEGLGTPREPRWLTDI------PA--TVELIA-------AAEVAVIGFFQDLEIPIVSIFRS 77

  Fly   172 FADKNREKYRFGHSSEKEVLDKQGET-DKIVLIRAPHLSNKFESSSIKFEGSSESD-----LSTF 230
            .|.:.:: ..||.|:..|||.....| :.|.|.|.  :.||    .::.:.....|     ||.|
  Rat    78 MAQQFQD-VSFGISNHSEVLTHYNVTSNSICLFRL--VDNK----QLRLDAEDIDDLDAAKLSRF 135

  Fly   231 VKEN-------FHGLVGHRTQDSVKDFQNPLITAYYSVDYQKNPKGTNYWRNRVLKVAKEFVGQI 288
            :..|       :..::|....:::......||....|.:|:::.:...       |.||.|.|||
  Rat   136 IHLNNLHWVTEYSPMIGAGLFNTMVQTHLLLIMNKASPEYEESLRSYQ-------KAAKLFQGQI 193

  Fly   289 NFAIASKDDFQH-------ELNEYG------YDFVGDKPVVLARDEKNLKYALKDEFSVENLQDF 340
            .|.:......::       .|.|..      |:.|.||...|.          ..|.:||.:|.|
  Rat   194 LFVLVDSGKRENGKVIAYFRLKESQLPALAIYESVDDKWDALT----------ITEVTVEKVQSF 248

  Fly   341 VEKLLANELEPYIKSEPIPESNDA 364
            ....|...|....|:|     ||:
  Rat   249 CNGFLKGMLLRDQKAE-----NDS 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ERp60NP_725084.2 ER_PDI_fam 23..479 CDD:273457 64/284 (23%)
PDI_a_PDIR 23..126 CDD:239295 5/18 (28%)
PDI_b_ERp57 133..235 CDD:239367 27/114 (24%)
PDI_b'_ERp72_ERp57 239..345 CDD:239371 25/118 (21%)
PDI_a_PDI_a'_C 365..467 CDD:239293 64/284 (23%)
Erp27NP_001100095.1 PDI_b_family 43..139 CDD:239279 27/117 (23%)
Thioredoxin_6 64..250 CDD:290560 47/209 (22%)
PDI_b'_family 156..253 CDD:239280 24/113 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350309
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D462118at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.