DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ERp60 and Tmx4

DIOPT Version :9

Sequence 1:NP_725084.2 Gene:ERp60 / 36270 FlyBaseID:FBgn0033663 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_001093999.1 Gene:Tmx4 / 296182 RGDID:1305146 Length:336 Species:Rattus norvegicus


Alignment Length:380 Identity:81/380 - (21%)
Similarity:123/380 - (32%) Gaps:130/380 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VLLLGFIAISS----GAEQDVLELGDDDFATTLKQHETTLVM-------FYAPWCGHCKRLKPE- 60
            |.|..::|.::    |.||..|. .::.....:.....||||       ||||||..|::...| 
  Rat     9 VFLAAWLAAAAAEAEGLEQAALP-AEESRVQPMTASNWTLVMEGEWMLKFYAPWCPSCQQTDSEW 72

  Fly    61 --YAKAAEIVKDDDPPIKLAKVD-CTEAGKETCSKYSVSGYPTLKIFRQDEVSQDYNGPREASGI 122
              :||..|.::     |.:.||| ..|.|  ...::.|:..|.. ...:|.:.:.|.||.....:
  Rat    73 ETFAKNGETLQ-----ISVGKVDVIQEPG--LSGRFFVTTLPAF-FHAKDGIFRRYRGPGIYEDL 129

  Fly   123 AKY-----------MRAQVGPASKTVRTVAELKKFLDTKDTTLFGYFSDSDSKLAKIFLKFADKN 176
            ..|           :.....|||.|:..:|              |.||.|    .||:       
  Rat   130 QNYILEKKWQSVEPLTGWKSPASLTMSGMA--------------GLFSIS----GKIW------- 169

  Fly   177 REKYRFGHSSEKEVLDKQGETDKIVLIRAPHLSNKFE--------SSSIKFEGSSESDLSTFVKE 233
                                          ||.|.|.        .|.:.|.      ::|.|..
  Rat   170 ------------------------------HLHNYFTVTLGIPAWCSYVFFV------IATLVFG 198

  Fly   234 NFHGLVGHRTQDSVKDFQNPLITAYYSVDYQKNPKGTNYWRNRVLKVAKEFVG--QINFAIASKD 296
            .|.||:               :.......|...|:.::. |:...:.::|..|  |:..|...||
  Rat   199 LFMGLI---------------LVVISECFYVPLPRASSE-RSEQEQRSEEAQGAEQLQDAEEEKD 247

  Fly   297 DFQHELN--------EYGYDFVGDKPVVLARDEKNLKYALKDEFSVENLQDFVEK 343
            |...|.|        |...|...|..|....:|.||...:.:|.|..|.|..|::
  Rat   248 DSNEEENKDSLVDDEEEKEDLGDDDEVEEDEEEDNLAGIMDEEKSDSNEQGVVKE 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ERp60NP_725084.2 ER_PDI_fam 23..479 CDD:273457 75/361 (21%)
PDI_a_PDIR 23..126 CDD:239295 29/124 (23%)
PDI_b_ERp57 133..235 CDD:239367 18/109 (17%)
PDI_b'_ERp72_ERp57 239..345 CDD:239371 24/115 (21%)
PDI_a_PDI_a'_C 365..467 CDD:239293
Tmx4NP_001093999.1 Thioredoxin_like 35..135 CDD:294274 28/107 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350316
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.