DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ERp60 and SPAC13F5.05

DIOPT Version :9

Sequence 1:NP_725084.2 Gene:ERp60 / 36270 FlyBaseID:FBgn0033663 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_593653.1 Gene:SPAC13F5.05 / 2542841 PomBaseID:SPAC13F5.05 Length:363 Species:Schizosaccharomyces pombe


Alignment Length:471 Identity:96/471 - (20%)
Similarity:170/471 - (36%) Gaps:159/471 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMWRLAGV--LLLGFIAISSGA-------EQDVLELGDDDFATTLKQHETTLVMFYAPWCGHCKR 56
            |::|:..:  |.|...::.||.       ..:.:||...:|...:|....:||:|||||||:||:
pombe     1 MLFRIPTLFTLFLACFSLVSGVFGYSPMFGSNTIELNSKNFRKFVKAKGPSLVVFYAPWCGYCKK 65

  Fly    57 LKPEYAKAAEIVKDDDPPIKLAKVDC-TEAGKETCSKYSVSGYPTLKIFRQDE-----VSQDYNG 115
            |.|.|.|.|..:....|   :..||| .:..:..||:|.|.|:||:|:.....     .|.||||
pombe    66 LVPTYQKLASNLHSLLP---VTAVDCDADQNRAVCSQYQVQGFPTIKLVYPSSKGSSLSSTDYNG 127

  Fly   116 PREASGIAKYMRAQVGPASKTVRTVAELKKFLDTKDTTLFGYFSDSDSKLAKIFLKFADKNREKY 180
            .|....:.|::...:....|.:.:.|:.:||:..                               
pombe   128 DRSYKSLQKFVSDSIPSKVKILTSEAKTQKFIQD------------------------------- 161

  Fly   181 RFGHSSEKEVLDKQGETDKIVLIRAPHLSNKFESSSIKFEGSSESDLSTFVKENFHGLVGHRTQD 245
              ..:|.|.:|..| :....:|.::  |||:|.|....|..:         |.|           
pombe   162 --AQNSSKVILISQ-KMKPTLLYKS--LSNEFSSLPFSFMPA---------KAN----------- 201

  Fly   246 SVKDFQNPLITAYYSVD-----YQKNP-KGTNYWRNRVLKVAKEFVGQINFAIASKDDFQHELNE 304
             |.|..|  |:||....     :.|:| .||:::.|   .:.::.:  :.|..:|..|  :..:|
pombe   202 -VNDLFN--ISAYVDTSDLPILFIKHPNNGTSFFSN---SLNRDSI--VEFLQSSIKD--NNFSE 256

  Fly   305 YGYDFVGDKPVVLARDEKNLKYALKDEFSVENLQDFVEKLLANELEPYIKSEPIPESNDAPVKVA 369
            |...|...|..::...:|:                                      :|:.:..:
pombe   257 YLATFCSKKSCIITIQDKD--------------------------------------SDSGIDES 283

  Fly   370 VAKNFDDL-VINNGKDTLIEFYAPWCGHCKKLSPIYEELAEKLQD------EDVAIVKMDATAND 427
            :.|.:..| .:..|::|.:                    ||:|:|      .|..::.:..:..:
pombe   284 IRKKYPKLHFVRLGRNTTV--------------------AERLEDTLDLGYSDTFLLSLKKSHYN 328

  Fly   428 VPPEFNVRGFPTLFWL 443
            ..|    .|.|...||
pombe   329 AKP----YGKPLRRWL 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ERp60NP_725084.2 ER_PDI_fam 23..479 CDD:273457 90/440 (20%)
PDI_a_PDIR 23..126 CDD:239295 39/108 (36%)
PDI_b_ERp57 133..235 CDD:239367 16/101 (16%)
PDI_b'_ERp72_ERp57 239..345 CDD:239371 19/111 (17%)
PDI_a_PDI_a'_C 365..467 CDD:239293 14/86 (16%)
SPAC13F5.05NP_593653.1 PDI_a_MPD1_like 32..139 CDD:239300 39/109 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.