DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ERp60 and ZK973.11

DIOPT Version :9

Sequence 1:NP_725084.2 Gene:ERp60 / 36270 FlyBaseID:FBgn0033663 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_491361.1 Gene:ZK973.11 / 172039 WormBaseID:WBGene00022836 Length:447 Species:Caenorhabditis elegans


Alignment Length:363 Identity:82/363 - (22%)
Similarity:134/363 - (36%) Gaps:59/363 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VLLLGFIAISSGAEQDVLELGDDDFATTLKQHETTLVMFYAPWCGHCKRLKPEYAKAAEIVKDDD 72
            |||..:...::.....||:|.|.  ...:|......|.||||||.|||||.|.:.:....:.|.:
 Worm    14 VLLFVYDTEATNPPTAVLDLSDK--FLDVKDEGMWFVEFYAPWCAHCKRLHPVWDQVGHTLSDSN 76

  Fly    73 PPIKLAKVDCTEAGKETCSKYSVSGYPTLKIFRQDEVSQDYNGPREASGIAKYMRAQVGPASKTV 137
            .||::.|:|||.. ....:|.|:.||||:..||...|. ||.|.||...:..:.:....|..:.:
 Worm    77 LPIRVGKLDCTRF-PAVANKLSIQGYPTILFFRNGHVI-DYRGGREKEALVSFAKRCAAPIIEVI 139

  Fly   138 RTVAELKKFLDTKDTTLFGYFSDSDSKLAKIFLKFADKNREKYRFGHSSEKEVLDKQGETDKIVL 202
            ......|..|..:....:.:|..|...|...|.:.|.......||...:..       |.|....
 Worm   140 NENQIEKVKLSARSQPSYVFFGTSSGPLFDAFNEAASSKFSVARFYSVAPP-------ENDASFR 197

  Fly   203 IRAPHLSNKFESSSIKFEGSSESDLSTFVKENFHGLV------------------------GHRT 243
            .|.....:.||   |:|.|..|.......:|.:.|.:                        .|:.
 Worm   198 QRVAVFKDNFE---IEFNGDIEKLTEWVTRERWPGFLQATSSNLAEIGASGKLVVLVVSSESHKF 259

  Fly   244 QDS--VKDFQNPLITAYYSVDYQKNPKGTNYWRNRVLKVAKEFVGQINFAIASKDD-FQHELNEY 305
            .::  :::|......|  |.:.:|:|...|.::...|. ..:...||..|..|:.. |......|
 Worm   260 NNTSPIREFHKTAEEA--SKELRKHPDLWNRFQFAWLD-GSDLASQIQMAAVSEPHLFIFNYTSY 321

  Fly   306 GYDFVGDKPVVLARDEKNLKYALKDEFSVENLQDFVEK 343
            .|....|:|               .:.:::::..|:|:
 Worm   322 EYYLSEDEP---------------SQMTIKSILTFLEQ 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ERp60NP_725084.2 ER_PDI_fam 23..479 CDD:273457 79/348 (23%)
PDI_a_PDIR 23..126 CDD:239295 39/102 (38%)
PDI_b_ERp57 133..235 CDD:239367 19/101 (19%)
PDI_b'_ERp72_ERp57 239..345 CDD:239371 19/132 (14%)
PDI_a_PDI_a'_C 365..467 CDD:239293
ZK973.11NP_491361.1 ER_PDI_fam 29..>348 CDD:273457 79/348 (23%)
PDI_a_TMX3 29..132 CDD:239298 39/106 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.