DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ERp60 and M04D5.1

DIOPT Version :9

Sequence 1:NP_725084.2 Gene:ERp60 / 36270 FlyBaseID:FBgn0033663 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_001251622.1 Gene:M04D5.1 / 13182108 WormBaseID:WBGene00014807 Length:332 Species:Caenorhabditis elegans


Alignment Length:358 Identity:89/358 - (24%)
Similarity:153/358 - (42%) Gaps:66/358 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 LDTKDTTLFGYFSDSDSKLAKIFLKFADKNREKYRFGHSSEKEV-----LDKQGETDKIVLIRAP 206
            :|.|......||..:|..||:||....:::.:.: :|.:...||     ||:.|    .|:|   
 Worm     2 IDKKRVVTLAYFEKTDFYLARIFELMYERDNDIF-YGITDSSEVAASVNLDEYG----FVII--- 58

  Fly   207 HLSNKFESSSIKFEGSSESDL----STFVKENFH----GLV---GHRTQDSVKDFQNPLITAYYS 260
              :...|...:::  .||.||    |.|::. :|    .||   ....:|:|:..|..::...| 
 Worm    59 --TKSKEGREMRY--FSEQDLAQDYSAFIRW-YHEFKLPLVITSRQNMKDAVETRQFNMVHVLY- 117

  Fly   261 VDYQKNPKGTNYWRNRVLKVAKEFVG--QINFAIASKDDFQHELNEY---------GYDFVGDKP 314
              .:|:....|...::....|:.|.|  :|.|.|...|:.:.  |.|         .|.......
 Worm   118 --IKKSDTDYNSTISKFTDTARRFHGRFKILFFIRHLDESRD--NTYIPKRIRFLINYSPTTTPS 178

  Fly   315 VVLARDEKNLKYALKDEFSVENLQDFVEKLLANELEPYIKSEPIPESNDA-PVKVAVAKNFDDLV 378
            .|:.: |:|..|.:.......:.::|...:|...:..|.:|:.:|:..|| ||||.|..||.::|
 Worm   179 SVIYK-ERNSHYVMFKLIGNSSFEEFTTSVLRGNVPRYYQSQDLPKDWDAKPVKVLVQSNFHEVV 242

  Fly   379 INNGKDTLIEFYAPWCGHCKKLSPIYEELAEKLQDEDVAIVKMDATANDVP-------PEFNVRG 436
            .|...:.|:.|...:...    .|..:||||:.: ..|.|.:||...|::|       |.:  |.
 Worm   243 FNKTNNVLVFFIETYYFD----EPALDELAEQFK-STVVIARMDTDKNEIPGMEIKENPTW--RL 300

  Fly   437 FPTLFWLPKDAKNKPVSYNGGRE-VDDFL-KYI 467
            :|.:..:|.|.|:   :|....| :.||| |:|
 Worm   301 WPAVTKIPVDFKD---AYGWNDEKLRDFLNKHI 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ERp60NP_725084.2 ER_PDI_fam 23..479 CDD:273457 89/358 (25%)
PDI_a_PDIR 23..126 CDD:239295
PDI_b_ERp57 133..235 CDD:239367 24/96 (25%)
PDI_b'_ERp72_ERp57 239..345 CDD:239371 22/119 (18%)
PDI_a_PDI_a'_C 365..467 CDD:239293 34/110 (31%)
M04D5.1NP_001251622.1 ER_PDI_fam <2..329 CDD:273457 87/355 (25%)
Thioredoxin_like 229..311 CDD:294274 26/88 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D462118at2759
OrthoFinder 1 1.000 - - FOG0000292
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.