DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ERp60 and PDIA6

DIOPT Version :9

Sequence 1:NP_725084.2 Gene:ERp60 / 36270 FlyBaseID:FBgn0033663 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_001269633.1 Gene:PDIA6 / 10130 HGNCID:30168 Length:492 Species:Homo sapiens


Alignment Length:462 Identity:98/462 - (21%)
Similarity:143/462 - (30%) Gaps:223/462 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FIAISS--GAEQDVLELGDDDFATTLKQHETT-LVMFYAPWCGHCKRLKPEYAKAAEIVKDDDPP 74
            |:|::.  .:..||:||...:|...:.|.::. ||.|||||||||:||.||:.|||..:||    
Human    66 FLAVNGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKD---- 126

  Fly    75 IKLAKVDCTEAGKETC--SKYSVSGYPTLKIFRQDE-VSQDYNGPREASGIAKYMRAQVGPASKT 136
              :.||...:|.|...  .:|.|.|:||:|||..:: ..:||.|.|....|.             
Human   127 --VVKVGAVDADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIV------------- 176

  Fly   137 VRTVAELKKFLDTKDTTLFGYFSDSDSKLAKIFLKFADKNREKYRFGHSSEKEVLDKQGETDKIV 201
                                     |:.|:.:      :...|.|.|..|......|||.:|   
Human   177 -------------------------DAALSAL------RQLVKDRLGGRSGGYSSGKQGRSD--- 207

  Fly   202 LIRAPHLSNKFESSSIKFEGSSESDLSTFVKENFHGLVGHRTQDSVKDFQNPLITAYYSVDYQKN 266
                               .||:.|:                                       
Human   208 -------------------SSSKKDV--------------------------------------- 214

  Fly   267 PKGTNYWRNRVLKVAKEFVGQINFAIASKDDFQHELNEYGYDFVGDKPVVLARDEKNLKYALKDE 331
                                     |...||                                  
Human   215 -------------------------IELTDD---------------------------------- 220

  Fly   332 FSVENLQDFVEKLLANELEPYIKSEPIPESNDAPVKVAVAKNFDDLVINNGKDTLIEFYAPWCGH 396
                                                     :||..|:::....::|||||||||
Human   221 -----------------------------------------SFDKNVLDSEDVWMVEFYAPWCGH 244

  Fly   397 CKKLSPIYEELAEKLQDEDVAIVKM---DATANDV-PPEFNVRGFPTLFWLPKDAKNKPVSYNGG 457
            ||.|.|.:...|.:::::....||:   |||.|.| ...:.:|||||:....|.  ..||.|:||
Human   245 CKNLEPEWAAAASEVKEQTKGKVKLAAVDATVNQVLASRYGIRGFPTIKIFQKG--ESPVDYDGG 307

  Fly   458 REVDDFL 464
            |...|.:
Human   308 RTRSDIV 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ERp60NP_725084.2 ER_PDI_fam 23..479 CDD:273457 96/450 (21%)
PDI_a_PDIR 23..126 CDD:239295 43/106 (41%)
PDI_b_ERp57 133..235 CDD:239367 13/101 (13%)
PDI_b'_ERp72_ERp57 239..345 CDD:239371 3/105 (3%)
PDI_a_PDI_a'_C 365..467 CDD:239293 37/104 (36%)
PDIA6NP_001269633.1 PDI_a_P5 78..180 CDD:239299 44/145 (30%)
PDI_a_P5 213..318 CDD:239299 41/243 (17%)
P5_C 327..456 CDD:239281
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.