DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ERp60 and erp27

DIOPT Version :9

Sequence 1:NP_725084.2 Gene:ERp60 / 36270 FlyBaseID:FBgn0033663 Length:489 Species:Drosophila melanogaster
Sequence 2:XP_017209875.1 Gene:erp27 / 100004902 -ID:- Length:252 Species:Danio rerio


Alignment Length:224 Identity:54/224 - (24%)
Similarity:91/224 - (40%) Gaps:26/224 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 AELKKFLDTKDTTLFGYFSDSDSKLAKIFLKFADKNREKYRFGHSSEKEVLDKQG-ETDKIVLIR 204
            |..:.|:|:.|..:.|:|.|..::....||. |.|..::......|||||..|.| .:|.|.:.|
Zfish    30 AAAQAFIDSADVAVIGFFQDESARGYSEFLD-AVKQMQELPVALCSEKEVWAKYGISSDTISVFR 93

  Fly   205 APHLSNKFESSSIKFEGSSESDLSTFVKENFHGLVGHRTQDSVKDFQNPLITAYYSV-------- 261
            ...|..:....|...:..|...|...:..|...:..:....:|..||:.:.|....|        
Zfish    94 KADLHQEHLKLSEAKKVDSAGLLRFLIINNISYVTEYNQASAVGIFQSSVKTHVLLVCAGGRSAS 158

  Fly   262 DYQKNPKGTNYWRNRVLKVAKEFVGQINFAIAS-KDDFQHELNEYGYDFVGDKPVV----LARDE 321
            |.|:     ..:|:    :|.::.|::.|.:.: .|.....:.||......|.|.|    :..|:
Zfish   159 DPQQ-----KLFRD----LAVKYAGKMLFILVNGADKSNSRVLEYFSLKSADLPRVGLYDVTLDQ 214

  Fly   322 KNLKYALKDEFSVENLQDFVEKLLANELE 350
            |.|..|  .|.:.|.:|:|.:..|..||:
Zfish   215 KWLMAA--GEITTERVQNFCDSFLDGELQ 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ERp60NP_725084.2 ER_PDI_fam 23..479 CDD:273457 54/224 (24%)
PDI_a_PDIR 23..126 CDD:239295
PDI_b_ERp57 133..235 CDD:239367 25/94 (27%)
PDI_b'_ERp72_ERp57 239..345 CDD:239371 25/118 (21%)
PDI_a_PDI_a'_C 365..467 CDD:239293
erp27XP_017209875.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D462118at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.