DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cuff and DXO1

DIOPT Version :9

Sequence 1:NP_610709.1 Gene:cuff / 36269 FlyBaseID:FBgn0260932 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_010658.3 Gene:DXO1 / 851976 SGDID:S000002778 Length:442 Species:Saccharomyces cerevisiae


Alignment Length:327 Identity:62/327 - (18%)
Similarity:115/327 - (35%) Gaps:90/327 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 KPVSNGWFAWSPIGQFEPNSQKVPYVVVPPSIKFPIS--LRYKDSPPKLEKKPNIFLDNMLQYIE 90
            |..|:...:..|..|.:...::.|.::..|...|..:  ..:...||:     :||.::....:.
Yeast    38 KTTSDSSSSRKPSQQRDNYRKRRPKLICIPYTSFLHTGMHNFLTKPPR-----DIFHESKEVALF 97

  Fly    91 SSSYMYVMVRNNQQAQLNANIVCTSEVLELMMCAPYEKKTGWSLGVTRYRN-----TMYICRIDV 150
            ::...|.::|.:....|..:|   :|:.|..:....::|..: ||...:.|     .|.|..:|.
Yeast    98 TNGRAYTILRKDLIPNLKESI---AELYESSLLEAKKRKVPY-LGHDLFANIDEFVPMTISELDS 158

  Fly   151 EQP--DPIDQ---DN--------------------LKRAMQEFWLRNLRTHCV---FENGIKMHQ 187
            ..|  ..|:.   ||                    :...|..|..||.:|..:   ...|:....
Yeast   159 VSPCFSYIENWILDNPGKDFKIGKKFTVVTTRHHIVDLTMHLFNRRNRQTSLIVTYMGAGLLSFC 223

  Fly   188 HNQSSEEHLRFHGVFSFDLNGNRVLF----------DSPVLAEM-----PSTTLNGSALS-WVDL 236
            .|...:..:...|::|.|.|..::.:          ::..:|::     |..:|..|.|| .:.|
Yeast   224 RNVKKDSQMSKEGIYSNDPNMKKICYSGFEFENWVTENSKVADLTGSKCPIFSLVESKLSEEIGL 288

  Fly   237 QIR--------------------PMFMSRLDWPEHN---RTEALKWWVKCFLLGIESLYIARRDE 278
            .||                    |:.|       ||   |.:.||.||:..||....:.|..||.
Yeast   289 LIRCEMDAFNPVSETNTELKCFAPLSM-------HNSNHRRKLLKTWVQTGLLPNSDIMIGLRDS 346

  Fly   279 NA 280
            ::
Yeast   347 HS 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cuffNP_610709.1 RAI1 <257..284 CDD:285815 9/24 (38%)
DXO1NP_010658.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12395
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.