DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG13185 and Pnliprp1

DIOPT Version :9

Sequence 1:	NP_001097279.2	Gene:	CG13185 / 36268	FlyBaseID:	FBgn0033661	Length:	5526	Species:	Drosophila melanogaster
Sequence 2:	NP_114470.1	Gene:	Pnliprp1 / 84028	RGDID:	620792	Length:	473	Species:	Rattus norvegicus

Alignment Length:	123	Identity:	26/123 - (21%)
Similarity:	41/123 - (33%)	Gaps:	28/123 - (22%)

- Green bases have known domain annotations that are detailed below.

  Fly  1252 KAHPNFMLFATQNPPG---------LYGGRKTLSRAFKNRFIELHFADIPREELETILEKRCFIP 1307
            |.:..|:|:..:||..         |..|......|.|.|||...|.|...|.....:.|..|
  Rat    51 KINTRFLLYTNENPTAFQTLQLSDPLTIGASNFQVARKTRFIIHGFIDKGEENWVVDMCKNMF-- 113

  Fly  1308 PTYARKMVQCM------------TQLQQHRKNTSKQVFTLRDLFRWGNRYTHADKSLH 1353
               ..:.|.|:            ||...:.:....||..:.|:.  ...|:::...:|
  Rat   114 ---QVEEVNCICVDWKKGSQTTYTQAANNVRVVGAQVAQMIDIL--VKNYSYSPSKVH 166

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG13185	NP_001097279.2	MDN1	298..5521	CDD:227596	26/123 (21%)
		P-loop_NTPase	315..505	CDD:304359
		P-loop_NTPase	<887..972	CDD:304359
		P-loop_NTPase	1147..1283	CDD:304359	9/39 (23%)
		P-loop_NTPase	1454..1603	CDD:304359
		P-loop_NTPase	1795..1946	CDD:304359
		P-loop_NTPase	<2335..>2378	CDD:304359
		Prothymosin	4843..4920	CDD:281265
		PHA03151	4856..5060	CDD:177546
		MttA_Hcf106	<5046..5166	CDD:294511
		vWA_midasin	5261..5526	CDD:238737
Pnliprp1	NP_114470.1	Lipase	18..353	CDD:395099	26/123 (21%)
Pnliprp1	NP_114470.1	PLAT_PL	356..467	CDD:238857
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910