DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13185 and AT5G03480

DIOPT Version :9

Sequence 1:NP_001097279.2 Gene:CG13185 / 36268 FlyBaseID:FBgn0033661 Length:5526 Species:Drosophila melanogaster
Sequence 2:NP_195968.1 Gene:AT5G03480 / 831825 AraportID:AT5G03480 Length:321 Species:Arabidopsis thaliana


Alignment Length:222 Identity:48/222 - (21%)
Similarity:77/222 - (34%) Gaps:70/222 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 LEFDQEREQAWNTARNTLC--SYTPDASDQLLNLHLHGINKSVTNIEGVLLP-TFNEENLE---- 281
            ||.:...:|:.:||   :|  .|.....:..|.|.|.....|...|..:.:| .|.::.|:    
plant    12 LELNDSDKQSTSTA---ICVEGYDTSLKEYPLRLALTKHFASCGEITQIYVPRDFKKKILKSVSF 73

  Fly   282 FYASTDGCYDRIVKVDSTVVNLRSIALGVAAAKPICLSGPVGCGKTTLIEYLARKTGRICPKPNE 346
            .:...:|..|:.:::..|.|.                      |.|.:::          |||  
plant    74 MWIKGEGAEDKALQLSGTDVG----------------------GWTVIVK----------PKP-- 104

  Fly   347 IESREKALKKAEEEEQLLTPKKKAKTTGSKRKLEEVPLEELLD-LGE-------------TTKKS 397
                     |.|....:.|...:...|..::.|.|:.||:..| .||             ..|..
plant   105 ---------KHEPPSPITTISVEGYDTSLQKYLLELILEKHFDSCGEIRHVYVPTDYERGVLKSV 160

  Fly   398 GFLRIQLGDQTDSKMLLGQYRCTDVPG 424
            .||||: |:..:.|.|  |...|||.|
plant   161 AFLRIE-GEGAEDKAL--QLSGTDVVG 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13185NP_001097279.2 MDN1 298..5521 CDD:227596 31/141 (22%)
P-loop_NTPase 315..505 CDD:304359 29/124 (23%)
P-loop_NTPase <887..972 CDD:304359
P-loop_NTPase 1147..1283 CDD:304359
P-loop_NTPase 1454..1603 CDD:304359
P-loop_NTPase 1795..1946 CDD:304359
P-loop_NTPase <2335..>2378 CDD:304359
Prothymosin 4843..4920 CDD:281265
PHA03151 4856..5060 CDD:177546
MttA_Hcf106 <5046..5166 CDD:294511
vWA_midasin 5261..5526 CDD:238737
AT5G03480NP_195968.1 RRM_SF 26..102 CDD:302621 16/107 (15%)
RRM_SF 114..192 CDD:302621 22/74 (30%)
RRM_SF 217..284 CDD:302621
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.