DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13185 and CG34447

DIOPT Version :9

Sequence 1:NP_001097279.2 Gene:CG13185 / 36268 FlyBaseID:FBgn0033661 Length:5526 Species:Drosophila melanogaster
Sequence 2:NP_001097060.1 Gene:CG34447 / 5740813 FlyBaseID:FBgn0085476 Length:389 Species:Drosophila melanogaster


Alignment Length:251 Identity:52/251 - (20%)
Similarity:90/251 - (35%) Gaps:78/251 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly  1693 FLDALEMLPHESQEQVELLKSNIVKQAIKQASLILQEKFTLEELSEKRGTEVELNECRFGIRPFF 1757
            ::.|::.||..|:...:|: :|:|.:||.....|....|:|       |.:|.      |....:
  Fly   119 YIQAVQNLPLVSRCLAQLI-NNLVDRAIVANDQIHLIGFSL-------GGQVA------GQTANY 169

  Fly  1758 IDVNQERLTSAKEDFLFDAPTTKQNLFRLLSALSLQKPVLLEGPPG----VGKTSIVESIGSAI- 1817
            :....:|:|                      .|...||:.:.||..    .|....|:.|.:.: 
  Fly   170 VKRKMKRIT----------------------GLDPAKPLFILGPDSRRLDKGDADFVDVIHTDVF 212

  Fly  1818 --GYQIVRINLCEHTDLADLFGTDLPA--EDNLLESNTAATERQIRSFVWRDGPLLAALKAKNTW 1878
              ||    :....|.|....||...|.  |:|:.:.::...||..|.:.          ::.||.
  Fly   213 GRGY----LRAAGHVDFYPNFGAKQPGCMEENMQDPSSCNHERAPRFYA----------ESINTT 263

  Fly  1879 I----------LLDELNLAPQSVLEGLNAVLDH------RGEVYIPELNKSFHLAG 1918
            :          ||..|.|.|.:   |..|:|.:      ||..::...:||.:..|
  Fly   264 VGFWARQCSGWLLQLLTLCPTT---GAQALLGYHVSDELRGSYFLQTASKSPYALG 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13185NP_001097279.2 MDN1 298..5521 CDD:227596 52/251 (21%)
P-loop_NTPase 315..505 CDD:304359
P-loop_NTPase <887..972 CDD:304359
P-loop_NTPase 1147..1283 CDD:304359
P-loop_NTPase 1454..1603 CDD:304359
P-loop_NTPase 1795..1946 CDD:304359 33/149 (22%)
P-loop_NTPase <2335..>2378 CDD:304359
Prothymosin 4843..4920 CDD:281265
PHA03151 4856..5060 CDD:177546
MttA_Hcf106 <5046..5166 CDD:294511
vWA_midasin 5261..5526 CDD:238737
CG34447NP_001097060.1 Pancreat_lipase_like 41..309 CDD:238363 49/242 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.