DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13185 and rbm39b

DIOPT Version :9

Sequence 1:NP_001097279.2 Gene:CG13185 / 36268 FlyBaseID:FBgn0033661 Length:5526 Species:Drosophila melanogaster
Sequence 2:NP_001014392.1 Gene:rbm39b / 541556 ZFINID:ZDB-GENE-050327-97 Length:539 Species:Danio rerio


Alignment Length:236 Identity:41/236 - (17%)
Similarity:76/236 - (32%) Gaps:74/236 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly  4838 FDIDAMKENMQPAEEPEADGDDEHDANEEGDPQSDGSDSEEDEAGTEAKPAEEDHGEGEEATPED 4902
            ||::||.|  .|..:.|:.....:..|||...:...|.|.....|     .......|.:.:.|.
Zfish     5 FDVEAMLE--APYRKGESKSSSANGHNEERSKKKRRSHSRSPSPG-----RRRSRSGGRKKSRER 62

  Fly  4903 EKDEAETQKRGELEDEDDSKPEDSPEDSKEEKEEKREEKPEEHSQSKDKASKEENVQSMPETDQS 4967
            .:..                       |:|.|..:.:|:....|:|||:..:..           
Zfish    63 RRSR-----------------------SRERKPSRSKERKRSRSRSKDRGGRSR----------- 93

  Fly  4968 SSADQVQQPQDPDIKQDQKLDEQETGEEKDGVGQAENDADDGGHQGVAETQETVSQEDRKNERQT 5032
                                     |.:...:||..|    ||..|....|.......:::..::
Zfish    94 -------------------------GRKSPFMGQKLN----GGPGGKTGPQHFPKHSRKRSRSKS 129

  Fly  5033 QEKRKQGRTNEERSLGEAEQNKLKQLKTIDQLKDSKESDDA 5073
            ..|:::....:::|..:.:::.::|  .||.|  |.|..||
Zfish   130 PFKKEKSPFKKDKSPFKKDKSPVRQ--PIDNL--SPEERDA 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13185NP_001097279.2 MDN1 298..5521 CDD:227596 41/236 (17%)
P-loop_NTPase 315..505 CDD:304359
P-loop_NTPase <887..972 CDD:304359
P-loop_NTPase 1147..1283 CDD:304359
P-loop_NTPase 1454..1603 CDD:304359
P-loop_NTPase 1795..1946 CDD:304359
P-loop_NTPase <2335..>2378 CDD:304359
Prothymosin 4843..4920 CDD:281265 12/76 (16%)
PHA03151 4856..5060 CDD:177546 27/203 (13%)
MttA_Hcf106 <5046..5166 CDD:294511 9/28 (32%)
vWA_midasin 5261..5526 CDD:238737
rbm39bNP_001014392.1 SF-CC1 76..526 CDD:273721 23/135 (17%)
RRM1_RBM39 166..250 CDD:240980 1/1 (100%)
RRM2_RBM23_RBM39 266..338 CDD:240730
RBM39linker 355..450 CDD:292157
RRM3_RBM39_like 432..516 CDD:240731
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.