DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13185 and PNLIP

DIOPT Version :9

Sequence 1:NP_001097279.2 Gene:CG13185 / 36268 FlyBaseID:FBgn0033661 Length:5526 Species:Drosophila melanogaster
Sequence 2:NP_000927.1 Gene:PNLIP / 5406 HGNCID:9155 Length:465 Species:Homo sapiens


Alignment Length:365 Identity:74/365 - (20%)
Similarity:113/365 - (30%) Gaps:136/365 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly  1741 GTEVELN-ECRFGIRPFFIDVNQERLTSAKEDFLFDAPTTKQNLFRLLSALSLQKPVLLEGPPGV 1804
            |:..:.| :.||.|.. |||..:|...:          ...:|||::.|...:  .|..:|....
Human    78 GSNFKTNRKTRFIIHG-FIDKGEENWLA----------NVCKNLFKVESVNCI--CVDWKGGSRT 129

  Fly  1805 GKTS--------------IVESIGSAIGYQIVRINLCEHT---------------DLADLFGTDL 1840
            |.|.              .||.:.||.||....:::..|:               .:..:.|.| 
Human   130 GYTQASQNIRIVGAEVAYFVEFLQSAFGYSPSNVHVIGHSLGAHAAGEAGRRTNGTIGRITGLD- 193

  Fly  1841 PAEDNLLESNTAATERQIRSFVWRDGPLLAALKAKNT----WILLDELNLAPQSVLEGLNAVLDH 1901
            |||.                 .::..|.|..|...:.    .|..|...:.| ::..|::.|:.|
Human   194 PAEP-----------------CFQGTPELVRLDPSDAKFVDVIHTDGAPIVP-NLGFGMSQVVGH 240

  Fly  1902 -----RGEVYIPELNKSF-----HLAG---STRIFACQNPLK----------QGGGRKGLPQSFL 1943
                 .|.|.:|...|:.     .:.|   .||.||..|.|:          ...|..|.|.:..
Human   241 LDFFPNGGVEMPGCKKNILSQIVDIDGIWEGTRDFAACNHLRSYKYYTDSIVNPDGFAGFPCASY 305

  Fly  1944 NRFT-------------------------------KVYLRKLSTEDLLHVVTEKY-------GKY 1970
            |.||                               |.|   |.|.|..:....:|       || 
Human   306 NVFTANKCFPCPSGGCPQMGHYADRYPGKTNDVGQKFY---LDTGDASNFARWRYKVSVTLSGK- 366

  Fly  1971 FDQLNAYFL-ELLDQKAEGNLFEIYSG--KESSCKSDSFD 2007
              ::..:.| .|...|.....:||:.|  |..|..|:.||
Human   367 --KVTGHILVSLFGNKGNSKQYEIFKGTLKPDSTHSNEFD 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13185NP_001097279.2 MDN1 298..5521 CDD:227596 74/365 (20%)
P-loop_NTPase 315..505 CDD:304359
P-loop_NTPase <887..972 CDD:304359
P-loop_NTPase 1147..1283 CDD:304359
P-loop_NTPase 1454..1603 CDD:304359
P-loop_NTPase 1795..1946 CDD:304359 40/206 (19%)
P-loop_NTPase <2335..>2378 CDD:304359
Prothymosin 4843..4920 CDD:281265
PHA03151 4856..5060 CDD:177546
MttA_Hcf106 <5046..5166 CDD:294511
vWA_midasin 5261..5526 CDD:238737
PNLIPNP_000927.1 Lipase 17..352 CDD:278576 60/308 (19%)
PLAT_PL 355..465 CDD:238857 14/53 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.