DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13185 and sxe2

DIOPT Version :9

Sequence 1:NP_001097279.2 Gene:CG13185 / 36268 FlyBaseID:FBgn0033661 Length:5526 Species:Drosophila melanogaster
Sequence 2:NP_001287352.1 Gene:sxe2 / 41954 FlyBaseID:FBgn0038398 Length:387 Species:Drosophila melanogaster


Alignment Length:331 Identity:75/331 - (22%)
Similarity:117/331 - (35%) Gaps:121/331 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   454 DTYTILSSLLERQCLSVPG----FRDSVKIEPGFQLFVTVR--TNKS--ASNSSQKSLYSLLDKY 510
            |.||.|:. .|||.|. ||    .|:| ...|.:.:.|::.  ..||  .||::.|..|  |.:.
  Fly    74 DLYTPLNP-EERQLLR-PGDLTMLRNS-HFNPKWPVRVSIHGWAGKSVTCSNAAIKDAY--LSRG 133

  Fly   511 LYTINILPLSRNELCKMVSINYPKLS----TVANRIVDV----------------FLTFSSGNHT 555
            .|.:.||..||..|    .|:||::|    ::|..:..:                .:..|:|:|.
  Fly   134 NYNVIILDWSRQSL----DISYPRVSKQLPSIAANVAKMLRFLHDNTGVPYEQIYMIGHSAGSHI 194

  Fly   556 SA-------------------DNLRQQESG--DKAD-NTEQYVALPFEQVPLTSSPNSGRLVSTR 598
            |.                   ..|.|...|  ::.| |...||......:.|..:|::       
  Fly   195 SGLTGKLLRPHRLGAIFALDPAGLTQLSLGPEERLDVNDALYVESIHTDLTLLGNPST------- 252

  Fly   599 DLVKLCHRS--------NPQF-SVTSSE----CAYFVFQNAVDVFCSYLPQSKEKVTLITSIGAK 650
               ||.|.|        .|.. :.|::|    |.:|.   |:..|...:.|.|....|..| .||
  Fly   253 ---KLSHASFFANWGLGQPHCPNATATEFDFVCDHFA---AMFYFAESVRQPKSFAALRCS-SAK 310

  Fly   651 LGIIRSRC-------EHFA------NEY-----------------KPDVEF----GLEHIKIGRA 681
             .::.:.|       |.:|      ||:                 :|...:    ||.|||..|.
  Fly   311 -SVLSATCNCNVGGSEKYAVNTCTGNEFMGGEPAVPKRGIFYLSTRPQSPYGTSDGLVHIKRPRP 374

  Fly   682 SLLAKS 687
            |.:.::
  Fly   375 STIRET 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13185NP_001097279.2 MDN1 298..5521 CDD:227596 75/331 (23%)
P-loop_NTPase 315..505 CDD:304359 19/58 (33%)
P-loop_NTPase <887..972 CDD:304359
P-loop_NTPase 1147..1283 CDD:304359
P-loop_NTPase 1454..1603 CDD:304359
P-loop_NTPase 1795..1946 CDD:304359
P-loop_NTPase <2335..>2378 CDD:304359
Prothymosin 4843..4920 CDD:281265
PHA03151 4856..5060 CDD:177546
MttA_Hcf106 <5046..5166 CDD:294511
vWA_midasin 5261..5526 CDD:238737
sxe2NP_001287352.1 Lipase 53..360 CDD:278576 68/309 (22%)
Pancreat_lipase_like 72..356 CDD:238363 67/305 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.