DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13185 and LPL

DIOPT Version :9

Sequence 1:NP_001097279.2 Gene:CG13185 / 36268 FlyBaseID:FBgn0033661 Length:5526 Species:Drosophila melanogaster
Sequence 2:NP_000228.1 Gene:LPL / 4023 HGNCID:6677 Length:475 Species:Homo sapiens


Alignment Length:457 Identity:85/457 - (18%)
Similarity:160/457 - (35%) Gaps:142/457 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly  3335 QRQQ--QLSQKLALRS------EKC-LYASLVQDIT--HFLHSNGDCESLYKLFQLIHSEWENFQ 3388
            ||:.  .:..|.|||:      :.| |...:.:.:.  ||.||:       |.|.:||. | ...
Human    30 QRRDFIDIESKFALRTPEDTAEDTCHLIPGVAESVATCHFNHSS-------KTFMVIHG-W-TVT 85

  Fly  3389 GLHVATSAQL---------KSSIEVLGKLDLWLANAQRFVHHTLSRYSAYY-----QDFVEPIKC 3439
            |::.:...:|         .|::.|:.    ||:.||.  |:.:   ||.|     ||....|..
Human    86 GMYESWVPKLVAALYKREPDSNVIVVD----WLSRAQE--HYPV---SAGYTKLVGQDVARFINW 141

  Fly  3440 SVNQLRFGLESLKVIFTRVQQ-----AGSVSQAEQMQQTIGDIVQFPSQHPLVIRNSRLYGLLAE 3499
            ...:..:.|:::.::...:..     |||::..                     :.:|:.||...
Human   142 MEEEFNYPLDNVHLLGYSLGAHAAGIAGSLTNK---------------------KVNRITGLDPA 185

  Fly  3500 LPHSEYEYFRLLKAKLSELSNYIALGRVIDET-------TFAAYDDALSICNQ------------ 3545
            .|:.||..   ..::||.           |:.       ||.......||..|            
Human   186 GPNFEYAE---APSRLSP-----------DDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNG 236

  Fly  3546 -TWQQEEHRRCQLKAEAESLYVTKTKGGVDSEELIEMQEIEHNFPTNLDEDFAEFVSQPTLEQVL 3609
             |:|.    .|.:   .|::.|...:|..|.::|:   :..|....:|           .::.:|
Human   237 GTFQP----GCNI---GEAIRVIAERGLGDVDQLV---KCSHERSIHL-----------FIDSLL 280

  Fly  3610 KLDKKASAKDKQSQIVVEEDYAFLARNFIDVMTRHTQVYYK-EQPKSSKELELHLLAPYQARFQV 3673
            ..:..:.|....|:...|:......|.     .|...:.|: .:.::.:..:::|....|..::|
Human   281 NEENPSKAYRCSSKEAFEKGLCLSCRK-----NRCNNLGYEINKVRAKRSSKMYLKTRSQMPYKV 340

  Fly  3674 FANLHGHYKTALG-SSLEERACNGLAFGLAL----QQKQLRDIELEEGVSSSPYDF--YKDSNIS 3731
            |     ||:..:. |..|.......||.::|    .:.:.....|.|..::..|.|  |.:.:|.
Human   341 F-----HYQVKIHFSGTESETHTNQAFEISLYGTVAESENIPFTLPEVSTNKTYSFLIYTEVDIG 400

  Fly  3732 EI 3733
            |:
Human   401 EL 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13185NP_001097279.2 MDN1 298..5521 CDD:227596 85/457 (19%)
P-loop_NTPase 315..505 CDD:304359
P-loop_NTPase <887..972 CDD:304359
P-loop_NTPase 1147..1283 CDD:304359
P-loop_NTPase 1454..1603 CDD:304359
P-loop_NTPase 1795..1946 CDD:304359
P-loop_NTPase <2335..>2378 CDD:304359
Prothymosin 4843..4920 CDD:281265
PHA03151 4856..5060 CDD:177546
MttA_Hcf106 <5046..5166 CDD:294511
vWA_midasin 5261..5526 CDD:238737
LPLNP_000228.1 Interaction with GPIHBP1. /evidence=ECO:0000269|PubMed:30559189 32..53 4/20 (20%)
Lipase 33..473 CDD:332983 83/454 (18%)
Essential for determining substrate specificity. /evidence=ECO:0000269|PubMed:7592706 243..266 6/28 (21%)
Important for interaction with lipoprotein particles. /evidence=ECO:0000269|PubMed:27929370 417..421
Important for heparin binding. /evidence=ECO:0000269|PubMed:11342582 430..434
Interaction with GPIHBP1. /evidence=ECO:0000269|PubMed:26725083, ECO:0000269|PubMed:30559189 443..467
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.