DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG13185 and Zg16b

DIOPT Version :9

Sequence 1:	NP_001097279.2	Gene:	CG13185 / 36268	FlyBaseID:	FBgn0033661	Length:	5526	Species:	Drosophila melanogaster
Sequence 2:	NP_001102293.2	Gene:	Zg16b / 363551	RGDID:	1562673	Length:	237	Species:	Rattus norvegicus

Alignment Length:	110	Identity:	30/110 - (27%)
Similarity:	42/110 - (38%)	Gaps:	23/110 - (20%)

- Green bases have known domain annotations that are detailed below.

  Fly  4796 QTNAMHNELEEPP-EPEEMDLGDMNNVDEGHDDQDEQPTDENPFDIDAMKENMQPAEEPEADGDD 4859
            :.|....:..||| ||...........|||.|:.|....|.|                  .||||
  Rat   150 EVNTKDLKATEPPREPVGSSEASDKKEDEGRDNDDVDDEDNN------------------KDGDD 196

  Fly  4860 EHDANEEGDPQSDGSDSEEDEAGTEAKPAEEDHGEGEEATPEDEK 4904
                .::||...||.|.|:.|.|.:.:..|:|.|..:....|:|:
  Rat   197 ----GDDGDDGDDGDDGEDGEDGEDGEDGEDDDGGDDNDGDEEEE 237

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG13185	NP_001097279.2	MDN1	298..5521	CDD:227596	30/110 (27%)
		P-loop_NTPase	315..505	CDD:304359
		P-loop_NTPase	<887..972	CDD:304359
		P-loop_NTPase	1147..1283	CDD:304359
		P-loop_NTPase	1454..1603	CDD:304359
		P-loop_NTPase	1795..1946	CDD:304359
		P-loop_NTPase	<2335..>2378	CDD:304359
		Prothymosin	4843..4920	CDD:281265	17/62 (27%)
		PHA03151	4856..5060	CDD:177546	17/49 (35%)
		MttA_Hcf106	<5046..5166	CDD:294511
		vWA_midasin	5261..5526	CDD:238737
Zg16b	NP_001102293.2	Jacalin_ZG16_like	22..150	CDD:187707	30/110 (27%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910