DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13185 and Prr4

DIOPT Version :9

Sequence 1:NP_001097279.2 Gene:CG13185 / 36268 FlyBaseID:FBgn0033661 Length:5526 Species:Drosophila melanogaster
Sequence 2:NP_976077.1 Gene:Prr4 / 360395 RGDID:735181 Length:247 Species:Rattus norvegicus


Alignment Length:224 Identity:60/224 - (26%)
Similarity:99/224 - (44%) Gaps:55/224 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly  4793 DEEQTNAMHNELEEPPEPEEMDLGDMNNVDEGHDDQDEQPTD--ENPFDIDAMKENMQPAEEPEA 4855
            |||..||   |..:.|.                 |.::||.|  .:|...||..||:|       
  Rat    20 DEEVNNA---ETSDVPA-----------------DSEQQPVDSGSDPPSADADAENVQ------- 57

  Fly  4856 DGDDEHDANEEGDPQSDGSDSE-EDEAGTEAKPAEEDHGEG-EEATPEDEKDEAETQK----RGE 4914
            :|:....|||| .|.:.||:.| :.:..|:|:..|.....| ||...:.|..:||.|:    .|.
  Rat    58 EGESAPPANEE-PPATSGSEEEQQQQEPTQAENQEPPATSGSEEEQQQQEPTQAENQEPPATSGS 121

  Fly  4915 LEDEDDSKP-----EDSPEDSKEEKEEKREEKPE-EHSQSKDKAS-------KEENVQSMPETDQ 4966
            .|::...:|     ::.|..|..|:|::::|..: |:.:..|.|.       :|.||:|.|.:.:
  Rat   122 EEEQQQQQPTQAENQEPPATSGSEEEQQQQESTQAENQEPSDSAGEGQETQPEEGNVESPPSSPE 186

  Fly  4967 SSSADQVQQPQDPDIKQDQKLDEQETGEE 4995
            :|.    :|||..:  .::|....:|.||
  Rat   187 NSQ----EQPQQTN--PEEKPPAPKTQEE 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13185NP_001097279.2 MDN1 298..5521 CDD:227596 60/224 (27%)
P-loop_NTPase 315..505 CDD:304359
P-loop_NTPase <887..972 CDD:304359
P-loop_NTPase 1147..1283 CDD:304359
P-loop_NTPase 1454..1603 CDD:304359
P-loop_NTPase 1795..1946 CDD:304359
P-loop_NTPase <2335..>2378 CDD:304359
Prothymosin 4843..4920 CDD:281265 24/82 (29%)
PHA03151 4856..5060 CDD:177546 43/159 (27%)
MttA_Hcf106 <5046..5166 CDD:294511
vWA_midasin 5261..5526 CDD:238737
Prr4NP_976077.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 14..219 60/224 (27%)
PRK07764 <21..209 CDD:236090 57/221 (26%)
5 X 23 AA tandem repeats 67..181 30/114 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100908
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.