DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13185 and CG12288

DIOPT Version :9

Sequence 1:NP_001097279.2 Gene:CG13185 / 36268 FlyBaseID:FBgn0033661 Length:5526 Species:Drosophila melanogaster
Sequence 2:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster


Alignment Length:413 Identity:76/413 - (18%)
Similarity:133/413 - (32%) Gaps:145/413 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly  4877 EEDEAGTEAKPAEEDHGEGEEA----------------TPEDEKDEAETQKRGELEDEDDSKPED 4925
            |.::|  |.||.:::.|..|:.                .|:||...|..:...:|..:|.:|.|.
  Fly     8 ESEKA--ELKPIKKEPGVVEDGKVTKKSKTKPKKKTVKVPKDEVKAAVQESPKKLSAKDLAKIEK 70

  Fly  4926 SPEDSKEEKEEKREEK---------PEEHSQSKDKASKEENVQSMPETDQSSSADQVQQPQDPDI 4981
            .....:.:|.:|::.|         ||...:.:.||:|:|.|:..|.|..:         :.|..
  Fly    71 KKAKKQAQKLKKQQNKLAPKEIKTEPEAQVKVESKATKKEKVEKEPTTAPN---------EKPKG 126

  Fly  4982 KQDQKLDEQETGEEKDGVGQAENDADDGGHQGVAETQETVSQEDRKNERQTQEKRKQ-------- 5038
            |..:|.......::::||.:..|.|::.....|...             ....||.|        
  Fly   127 KVSKKAKANANNKDEEGVKRIRNPAEEASTVFVGNL-------------PINTKRVQLVKLFQPY 178

  Fly  5039 --GRTNEERSLGEAEQNKLKQLKTIDQLKDSKESDDAEQEKPEPMDQ------------------ 5083
              .::...|:.|..:..|.||.|....|     :.....||||...|                  
  Fly   179 GLVQSIRLRTAGGKQLFKHKQRKVAGSL-----NAYVVLEKPEIAQQALALNGSEFKENHLRVTP 238

  Fly  5084 -TEAEEYQHVKEPKNSDK---------TTLDNATEEQSKKIQHQ--------------------- 5117
             :.||::...|:.:.|||         :...:|||||.::|...                     
  Fly   239 ASMAEKFGQAKDKQPSDKDAKRTIFVGSLKYSATEEQLREIFSSCGEIDYIRCLQDGDKGCKGVA 303

  Fly  5118 ---------------------EDEPPNEEEIEAENVDELMEAEEPAVDPEDDAELEQLGAEKTEQ 5161
                                 :|.|.|.|..:.:.:......:..|..          .|.||..
  Fly   304 YVCFQKPDAVGLALELNQTLLDDRPINVERYQVKKLGAKQVRDAAAAS----------AASKTSS 358

  Fly  5162 KSD-KPSKTEKSKEQLETPEGME 5183
            |:. |...:..:|::|:..:|.|
  Fly   359 KTKAKNQNSAGAKKRLDKKKGKE 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13185NP_001097279.2 MDN1 298..5521 CDD:227596 76/413 (18%)
P-loop_NTPase 315..505 CDD:304359
P-loop_NTPase <887..972 CDD:304359
P-loop_NTPase 1147..1283 CDD:304359
P-loop_NTPase 1454..1603 CDD:304359
P-loop_NTPase 1795..1946 CDD:304359
P-loop_NTPase <2335..>2378 CDD:304359
Prothymosin 4843..4920 CDD:281265 12/58 (21%)
PHA03151 4856..5060 CDD:177546 43/217 (20%)
MttA_Hcf106 <5046..5166 CDD:294511 32/190 (17%)
vWA_midasin 5261..5526 CDD:238737
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 16/99 (16%)
RRM_SF 261..332 CDD:302621 9/70 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.