DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13185 and CG18641

DIOPT Version :9

Sequence 1:NP_001097279.2 Gene:CG13185 / 36268 FlyBaseID:FBgn0033661 Length:5526 Species:Drosophila melanogaster
Sequence 2:NP_608682.3 Gene:CG18641 / 33429 FlyBaseID:FBgn0031426 Length:369 Species:Drosophila melanogaster


Alignment Length:414 Identity:75/414 - (18%)
Similarity:128/414 - (30%) Gaps:163/414 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   802 PLRNEF-EYLLCETFNQEKNLQFLRLFATHYNSGRHAVII-----RTMINI---CLQ-------- 849
            |:|.:| ..|||.:|.     .|...||...|:|..|..:     :|.:.:   |||        
  Fly     9 PIRADFWLQLLCVSFT-----LFHLEFAAAQNAGVVAAAVAAGQNQTQVYVTDSCLQKPYRCPHP 68

  Fly   850 ----------VAKNPE----LKANKLL-----PRWQTLREKLQKLQMQ-------LDKSINISFA 888
                      ..:.||    |..|.|.     ||..|      |:.:.       |..|.::..|
  Fly    69 KIQFYLYTRRTQEQPEFIDVLDPNALYYTHFNPRHPT------KIIIHGFGGGRTLSPSPDLREA 127

  Fly   889 FIPGSLVN-------------CISNGDW----------------------VLLDEINL----ASA 914
            :......|             |:|..||                      |..|:::.    ..|
  Fly   128 YFSVGEYNIIIVDYADAVKEPCLSQMDWAPRFGSLCISQLVKYLARHPRGVQPDDLHFIGYSVGA 192

  Fly   915 ETLECLSTILEPE----GSVVLLERGDFTPVKRHPDFRIFACMNPNTDIGKKDLPVGIRNRFTEF 975
            .....::..|:||    |.:..|:          |....:|..|.:.|:...|          ..
  Fly   193 HIAGLVANYLKPEEGKLGRITALD----------PTIFFYAGANNSRDLDSTD----------AH 237

  Fly   976 FVDELTTDADL-----SLLVSDYLANTGIQRKSVHNIVQLYKSL----RKLSELQLNDGLGNRPV 1031
            |||.|.|.|.:     |...:|:..|.|.::.:......|:::|    .|::.            
  Fly   238 FVDVLHTGAGILGQWHSSGHADFYVNGGTRQPACVGSATLFQTLACDHTKVTP------------ 290

  Fly  1032 YSLRTLCRSLRICARNLCGSIERNLYESFCLSFLTQL----DPNSHHVVLL---LIQNA-----L 1084
            |.:.::             :..|..|...|.:..:.|    :|.....||:   ....|     :
  Fly   291 YFIESI-------------TTTRGFYAGPCPNLFSYLIGWCEPKDSEYVLMGEHCSHKARGNYYV 342

  Fly  1085 LSNVKAILSKQLPQLGENYLDFEG 1108
            .:|.||..::..|..|.:..:::|
  Fly   343 TTNAKAPFARGFPGKGRSNGEYQG 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13185NP_001097279.2 MDN1 298..5521 CDD:227596 75/414 (18%)
P-loop_NTPase 315..505 CDD:304359
P-loop_NTPase <887..972 CDD:304359 19/127 (15%)
P-loop_NTPase 1147..1283 CDD:304359
P-loop_NTPase 1454..1603 CDD:304359
P-loop_NTPase 1795..1946 CDD:304359
P-loop_NTPase <2335..>2378 CDD:304359
Prothymosin 4843..4920 CDD:281265
PHA03151 4856..5060 CDD:177546
MttA_Hcf106 <5046..5166 CDD:294511
vWA_midasin 5261..5526 CDD:238737
CG18641NP_608682.3 Pancreat_lipase_like 68..346 CDD:238363 52/328 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.