DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13185 and GAP43

DIOPT Version :9

Sequence 1:NP_001097279.2 Gene:CG13185 / 36268 FlyBaseID:FBgn0033661 Length:5526 Species:Drosophila melanogaster
Sequence 2:NP_001123536.1 Gene:GAP43 / 2596 HGNCID:4140 Length:274 Species:Homo sapiens


Alignment Length:253 Identity:55/253 - (21%)
Similarity:96/253 - (37%) Gaps:70/253 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly  4800 MHNELEEPPEPEEMDLGDM----NNVDEGHDDQDEQPTDENPFD--------IDA---------- 4842
            :...|:....|....||.:    :.|::..|||..:.....|.|        |.|          
Human    22 LRKNLQRAVRPSPYSLGFLTFWISRVEKNDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKK 86

  Fly  4843 ----MKENMQPA--------EEPEADGDD---EHDANEEGDPQSDGSDSEEDEAGTEAKPAEEDH 4892
                .|:::|.|        |.|.|||.:   |.....|..|.:.....|..:||  ..|:||..
Human    87 LKGEKKDDVQAAEAEANKKDEAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAG--ETPSEEKK 149

  Fly  4893 GEGEEATPE--DEKDEAETQKRGELEDED------DSKPEDSPEDSKEEKEEKREEKP------- 4942
            |||:.||.:  .:...:..:|.|..|.|.      |:.|....||:..::|.|:.:.|       
Human   150 GEGDAATEQAAPQAPASSEEKAGSAETESATKASTDNSPSSKAEDAPAKEEPKQADVPAAVTAAA 214

  Fly  4943 ---------------EEHSQSKDKASKEENVQSMPETDQSSSADQVQ-QPQDPDIKQD 4984
                           :..:::.:.:..|||::::.||....||.|.: :.::|:..|:
Human   215 ATTPAAEDAAAKATAQPPTETGESSQAEENIEAVDETKPKESARQDEGKEEEPEADQE 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13185NP_001097279.2 MDN1 298..5521 CDD:227596 55/253 (22%)
P-loop_NTPase 315..505 CDD:304359
P-loop_NTPase <887..972 CDD:304359
P-loop_NTPase 1147..1283 CDD:304359
P-loop_NTPase 1454..1603 CDD:304359
P-loop_NTPase 1795..1946 CDD:304359
P-loop_NTPase <2335..>2378 CDD:304359
Prothymosin 4843..4920 CDD:281265 26/95 (27%)
PHA03151 4856..5060 CDD:177546 37/163 (23%)
MttA_Hcf106 <5046..5166 CDD:294511
vWA_midasin 5261..5526 CDD:238737
GAP43NP_001123536.1 IQ 66..88 CDD:197470 2/21 (10%)
DUF2413 89..>203 CDD:287302 31/115 (27%)
Neuromodulin 107..274 CDD:284117 40/168 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.