DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13185 and GABRE

DIOPT Version :9

Sequence 1:NP_001097279.2 Gene:CG13185 / 36268 FlyBaseID:FBgn0033661 Length:5526 Species:Drosophila melanogaster
Sequence 2:NP_004952.2 Gene:GABRE / 2564 HGNCID:4085 Length:506 Species:Homo sapiens


Alignment Length:408 Identity:75/408 - (18%)
Similarity:140/408 - (34%) Gaps:126/408 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly  1117 EPQPCTHYILTESVKKNLKDLARIISIGKLPILLQGPTSAGKTSLIDYVARRSGNRCLR--INNH 1179
            :|||..:.:|:|..|....:...  .:||||                     ..:|.|.  ::|:
Human    41 QPQPLENQLLSEETKSTETETGS--RVGKLP---------------------EASRILNTILSNY 82

  Fly  1180 EHTDLQEYIGTYAADLDGKLTFRE-GVL-VQAMRHGFWIILDEL----NLASTDILEALNRVLDD 1238
            :| .|:..||.....:..:::... |.| :..|.:...||..:.    .|...|..|:|  ||:.
Human    83 DH-KLRPGIGEKPTVVTVEISVNSLGPLSILDMEYTIDIIFSQTWYDERLCYNDTFESL--VLNG 144

  Fly  1239 N--RELYIAET--QTLVKAH------PNFMLFATQNPPGLYGGRKTLSRAFKNRFIELHFADIPR 1293
            |  .:|:|.:|  :...:.|      ||.|:...::...||..|.|:...     ..||....|.
Human   145 NVVSQLWIPDTFFRNSKRTHEHEITMPNQMVRIYKDGKVLYTIRMTIDAG-----CSLHMLRFPM 204

  Fly  1294 EELETILEKRCFIPPTYARKMVQCMTQLQQHRKNTSKQVFTLRDLFRWGNRYTHADKSLHDDNRY 1358
            :.....|....|..|  ..:|:                       ::|.|      ..|..:.:.
Human   205 DSHSCPLSFSSFSYP--ENEMI-----------------------YKWEN------FKLEINEKN 238

  Fly  1359 DWNQHLVEEGYLVLSSK--VRSQEEHELIEKTLFANFRKKL-----------DLQTL-----FDI 1405
            .|.  |.:..:..:|:|  :.:....:.:..|:|.|..::.           .:.|:     |.|
Human   239 SWK--LFQFDFTGVSNKTEIITTPVGDFMVMTIFFNVSRRFGYVAFQNYVPSSVTTMLSWVSFWI 301

  Fly  1406 QTD----RESSSMVSRKILDAIRNFKLRDDIVWTRNMTRMAVVTAKALEFDEPVLLVGPTGCGKT 1466
            :|:    |.|..:.|...:..:..|.       .:|..|::.:|  ||:|             ..
Human   302 KTESAPARTSLGITSVLTMTTLGTFS-------RKNFPRVSYIT--ALDF-------------YI 344

  Fly  1467 TVCQLLASIADVQLRILN 1484
            .:|.:....|.::..:||
Human   345 AICFVFCFCALLEFAVLN 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13185NP_001097279.2 MDN1 298..5521 CDD:227596 75/408 (18%)
P-loop_NTPase 315..505 CDD:304359
P-loop_NTPase <887..972 CDD:304359
P-loop_NTPase 1147..1283 CDD:304359 31/153 (20%)
P-loop_NTPase 1454..1603 CDD:304359 4/31 (13%)
P-loop_NTPase 1795..1946 CDD:304359
P-loop_NTPase <2335..>2378 CDD:304359
Prothymosin 4843..4920 CDD:281265
PHA03151 4856..5060 CDD:177546
MttA_Hcf106 <5046..5166 CDD:294511
vWA_midasin 5261..5526 CDD:238737
GABRENP_004952.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..66 6/26 (23%)
Neur_chan_LBD 71..276 CDD:280998 47/245 (19%)
Neur_chan_memb 285..>408 CDD:280999 18/100 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 413..438
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.