DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13185 and GABRA4

DIOPT Version :9

Sequence 1:NP_001097279.2 Gene:CG13185 / 36268 FlyBaseID:FBgn0033661 Length:5526 Species:Drosophila melanogaster
Sequence 2:NP_000800.2 Gene:GABRA4 / 2557 HGNCID:4078 Length:554 Species:Homo sapiens


Alignment Length:399 Identity:86/399 - (21%)
Similarity:135/399 - (33%) Gaps:112/399 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   366 PKKKAKTTGSK--RKLEEVPLEELLDLGETTKKSGFLRIQLGDQTDS----KMLLGQYRCTDV-- 422
            ||.:...|.:|  .|..|||.|          .|..::..|..||.|    |.:.|:|....|  
Human   196 PKSEMIYTWTKGPEKSVEVPKE----------SSSLVQYDLIGQTVSSETIKSITGEYIVMTVYF 250

  Fly   423 -----PGEFV---WLPGVLTQAVMH-GYWLLLEDLDAATQDTYTILSSLLERQCLSVPGFRDSVK 478
                 .|.|:   ::|.::|..:.. .:|:..|.:.|.|....|   ::|....||:.......|
Human   251 HLRRKMGYFMIQTYIPCIMTVILSQVSFWINKESVPARTVFGIT---TVLTMTTLSISARHSLPK 312

  Fly   479 IE--PGFQLFVTV-----------------RTNKSASNSSQKSLYSLLDKYLYTINILPLSRNE- 523
            :.  .....|:.|                 .||.....:.:|:     .|....:...|:.|.: 
Human   313 VSYATAMDWFIAVCFAFVFSALIEFAAVNYFTNIQMEKAKRKT-----SKPPQEVPAAPVQREKH 372

  Fly   524 -------------LCKMVSINYPKLSTVANRIVDVFLTFSSGNHTSADNLRQQESGDKADNTEQY 575
                         :.|..:......|.|.||.       ..|||:|..:...|||  .......|
Human   373 PEAPLQNTNANLNMRKRTNALVHSESDVGNRT-------EVGNHSSKSSTVVQES--SKGTPRSY 428

  Fly   576 VALPFEQVPLTSSPNSGRLVSTRDLVKLCHRSNPQFSVTSSECAYFVFQNAV------DVFCSYL 634
            :|         ||||.....:..:.:... |:.|..|.||....|...:.:|      .||.|.|
Human   429 LA---------SSPNPFSRANAAETISAA-RALPSASPTSIRTGYMPRKASVGSASTRHVFGSRL 483

  Fly   635 PQSKEKVTLITSIGA--KL------------GIIRSRCEHFANEYKPDVEFGLEHIKIGRASLLA 685
            .:.|   |.:.:|||  ||            |...|:.:.:|....| |.||..:: :.....|:
Human   484 QRIK---TTVNTIGATGKLSATPPPSAPPPSGSGTSKIDKYARILFP-VTFGAFNM-VYWVVYLS 543

  Fly   686 KSDLNNSEN 694
            |..:..||:
Human   544 KDTMEKSES 552

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13185NP_001097279.2 MDN1 298..5521 CDD:227596 86/399 (22%)
P-loop_NTPase 315..505 CDD:304359 36/174 (21%)
P-loop_NTPase <887..972 CDD:304359
P-loop_NTPase 1147..1283 CDD:304359
P-loop_NTPase 1454..1603 CDD:304359
P-loop_NTPase 1795..1946 CDD:304359
P-loop_NTPase <2335..>2378 CDD:304359
Prothymosin 4843..4920 CDD:281265
PHA03151 4856..5060 CDD:177546
MttA_Hcf106 <5046..5166 CDD:294511
vWA_midasin 5261..5526 CDD:238737
GABRA4NP_000800.2 Neur_chan_LBD 13..541 CDD:332142 82/386 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 350..381 4/35 (11%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 397..435 16/55 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 452..471 5/18 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 495..515 4/19 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.