Sequence 1: | NP_001097279.2 | Gene: | CG13185 / 36268 | FlyBaseID: | FBgn0033661 | Length: | 5526 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_038941215.1 | Gene: | Sbp / 25540 | RGDID: | 3623 | Length: | 367 | Species: | Rattus norvegicus |
Alignment Length: | 203 | Identity: | 59/203 - (29%) |
---|---|---|---|
Similarity: | 84/203 - (41%) | Gaps: | 68/203 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 4732 GKGSKDEKDAHNDLDTKNDAAKEDGKDEHEKDGLDATNEPSGEDKRKEQAKDIDDMKDPEMDEEQ 4796
Fly 4797 TNAMHNELEEPPEPEEMDLGDMNNVDEGHDDQDEQPTDENPFDIDAMKENMQPAEEPEADGDDEH 4861
Fly 4862 DANE-EGDPQSDGSDSEEDEAGTEAKPAEEDHGEGEEATPEDEKDEAETQKRGELEDEDDSKPED 4925
Fly 4926 SPEDSKEE 4933 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG13185 | NP_001097279.2 | MDN1 | 298..5521 | CDD:227596 | 59/203 (29%) |
P-loop_NTPase | 315..505 | CDD:304359 | |||
P-loop_NTPase | <887..972 | CDD:304359 | |||
P-loop_NTPase | 1147..1283 | CDD:304359 | |||
P-loop_NTPase | 1454..1603 | CDD:304359 | |||
P-loop_NTPase | 1795..1946 | CDD:304359 | |||
P-loop_NTPase | <2335..>2378 | CDD:304359 | |||
Prothymosin | 4843..4920 | CDD:281265 | 20/77 (26%) | ||
PHA03151 | 4856..5060 | CDD:177546 | 23/79 (29%) | ||
MttA_Hcf106 | <5046..5166 | CDD:294511 | |||
vWA_midasin | 5261..5526 | CDD:238737 | |||
Sbp | XP_038941215.1 | Jacalin_ZG16_like | 110..238 | CDD:187707 | 3/6 (50%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |