DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG13185 and Pnliprp2

DIOPT Version :9

Sequence 1:	NP_001097279.2	Gene:	CG13185 / 36268	FlyBaseID:	FBgn0033661	Length:	5526	Species:	Drosophila melanogaster
Sequence 2:	NP_035258.2	Gene:	Pnliprp2 / 18947	MGIID:	1336202	Length:	482	Species:	Mus musculus

Alignment Length:	139	Identity:	30/139 - (21%)
Similarity:	53/139 - (38%)	Gaps:	39/139 - (28%)

- Green bases have known domain annotations that are detailed below.

  Fly  2401 TNFRAFLTVDPKNGELSRAMRNRCVELS---LSRDTYSVDDLRAFVH------EQG--------V 2448
            |.|..:...:|.|.::..|.....:..|   |.|.|      |..:|      |:|        :
Mouse    67 TRFLLYTNENPNNYQIISATDPATINASNFQLDRKT------RFIIHGFIDKGEEGWLLDMCKKM 125

  Fly  2449 REMEAIDCILRVHKGLSQLTEFNNYSISHLTQFAFLSAAY--RRIGYELKRAIYVAAMEVYVYSA 2511
            .::|.::||         ..::...|.:..||     |:|  |.:|.|:...:.|.:.|:.....
Mouse   126 FQVEKVNCI---------CVDWKRGSRTEYTQ-----ASYNTRVVGAEIAFLVQVLSTEMGYSPE 176

  Fly  2512 NTDLMGYGL 2520
            |..|:|:.|
Mouse   177 NVHLIGHSL 185

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG13185	NP_001097279.2	MDN1	298..5521	CDD:227596	30/139 (22%)
		P-loop_NTPase	315..505	CDD:304359
		P-loop_NTPase	<887..972	CDD:304359
		P-loop_NTPase	1147..1283	CDD:304359
		P-loop_NTPase	1454..1603	CDD:304359
		P-loop_NTPase	1795..1946	CDD:304359
		P-loop_NTPase	<2335..>2378	CDD:304359
		Prothymosin	4843..4920	CDD:281265
		PHA03151	4856..5060	CDD:177546
		MttA_Hcf106	<5046..5166	CDD:294511
		vWA_midasin	5261..5526	CDD:238737
Pnliprp2	NP_035258.2	Lipase	31..367	CDD:278576	30/139 (22%)
		Pancreat_lipase_like	65..363	CDD:238363	30/139 (22%)
		Required for galactolipase activity. /evidence=ECO:0000250\|UniProtKB:P54317	106..118		3/11 (27%)
		Required for galactolipase activity. /evidence=ECO:0000250\|UniProtKB:P54317	270..292
		PLAT_PL	370..482	CDD:238857
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910