DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13185 and F56A11.6

DIOPT Version :9

Sequence 1:NP_001097279.2 Gene:CG13185 / 36268 FlyBaseID:FBgn0033661 Length:5526 Species:Drosophila melanogaster
Sequence 2:NP_499950.3 Gene:F56A11.6 / 176884 WormBaseID:WBGene00018926 Length:419 Species:Caenorhabditis elegans


Alignment Length:282 Identity:66/282 - (23%)
Similarity:121/282 - (42%) Gaps:46/282 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly  4775 DKRKEQAKDIDDMKDPEMDEEQTNAMHNELEEPPEPEEMDLGDMNNVDEGHDDQDEQPTDENPFD 4839
            :.||..|:   |.:.|....:..::||.    ||.|    .|..::.|...|::|.:.|:    |
 Worm   181 EPRKHPAR---DERRPRSRRQSPSSMHG----PPPP----YGPPSDDDRRRDEEDRRRTE----D 230

  Fly  4840 IDAMKE-NMQPAEEPEADGDD-EHDANEEGDPQSDGSDSEEDEAGTEAKPAEEDHGEGEEATPED 4902
            :|..|: :::..||......| |.|       :|.|.:.......:..|..:.|       ....
 Worm   231 VDRSKDRSLKRREERSRSRQDRERD-------RSRGGEKSRSPRKSHQKSVDRD-------KTRS 281

  Fly  4903 EKDEAETQKRGELEDEDDSKPEDSPEDSKEEKEEKREEKPEEHSQSKDKASKEENVQSMPETDQS 4967
            :||.:.::|     |.:|...|.|.:| :|:::.:|..|..|....||:..:|.. :|..|.:..
 Worm   282 DKDRSRSRK-----DREDRDRERSRKD-REDRDRERSRKEREDRSRKDREDRERE-RSRKEREDR 339

  Fly  4968 SSADQVQQPQDPDIKQDQKLDEQETGEEKDGVGQAENDADDGGHQGVAETQETVSQEDRKNERQT 5032
            |..|:.:..||.: .:|:..|...:.:::|....:....||...    |.::..|::||:..|..
 Worm   340 SRKDRERSRQDRE-DRDRDRDRDRSRKDRDDKSCSRRSRDDRSE----ERKDRKSRDDRERPRSR 399

  Fly  5033 QEKRKQGRTNEERSLGEAEQNK 5054
            |:|.|. |:.|:|.  .:..||
 Worm   400 QDKSKT-RSVEDRP--RSRSNK 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13185NP_001097279.2 MDN1 298..5521 CDD:227596 66/282 (23%)
P-loop_NTPase 315..505 CDD:304359
P-loop_NTPase <887..972 CDD:304359
P-loop_NTPase 1147..1283 CDD:304359
P-loop_NTPase 1454..1603 CDD:304359
P-loop_NTPase 1795..1946 CDD:304359
P-loop_NTPase <2335..>2378 CDD:304359
Prothymosin 4843..4920 CDD:281265 14/78 (18%)
PHA03151 4856..5060 CDD:177546 46/200 (23%)
MttA_Hcf106 <5046..5166 CDD:294511 2/9 (22%)
vWA_midasin 5261..5526 CDD:238737
F56A11.6NP_499950.3 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.