| Sequence 1: | NP_001097279.2 | Gene: | CG13185 / 36268 | FlyBaseID: | FBgn0033661 | Length: | 5526 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001289927.1 | Gene: | LIPI / 149998 | HGNCID: | 18821 | Length: | 460 | Species: | Homo sapiens |
| Alignment Length: | 231 | Identity: | 47/231 - (20%) |
|---|---|---|---|
| Similarity: | 74/231 - (32%) | Gaps: | 87/231 - (37%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 3582 QEIEHNFPTNLDEDFAEFVSQPTLEQVLKLDKKASAKDKQSQIVVEEDYAFLARNFIDVMTRHTQ 3646
Fly 3647 VYYKEQPKSSKELELHLLAPYQA----------------RFQVFANLHGHY-------------- 3681
Fly 3682 -KTALGSSLEERACN--GLAFGLALQQKQLRDIELEE------------GVSSSPYDFYKDSNIS 3731
Fly 3732 EIQSCLDVMERIEKRVLEQLEQYPEHAGLADIKLVI 3767 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG13185 | NP_001097279.2 | MDN1 | 298..5521 | CDD:227596 | 47/231 (20%) |
| P-loop_NTPase | 315..505 | CDD:304359 | |||
| P-loop_NTPase | <887..972 | CDD:304359 | |||
| P-loop_NTPase | 1147..1283 | CDD:304359 | |||
| P-loop_NTPase | 1454..1603 | CDD:304359 | |||
| P-loop_NTPase | 1795..1946 | CDD:304359 | |||
| P-loop_NTPase | <2335..>2378 | CDD:304359 | |||
| Prothymosin | 4843..4920 | CDD:281265 | |||
| PHA03151 | 4856..5060 | CDD:177546 | |||
| MttA_Hcf106 | <5046..5166 | CDD:294511 | |||
| vWA_midasin | 5261..5526 | CDD:238737 | |||
| LIPI | NP_001289927.1 | Pancreat_lipase_like | 41..309 | CDD:238363 | 20/91 (22%) |
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||