Sequence 1: | NP_001097279.2 | Gene: | CG13185 / 36268 | FlyBaseID: | FBgn0033661 | Length: | 5526 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_525129.1 | Gene: | TCEAL2 / 140597 | HGNCID: | 29818 | Length: | 227 | Species: | Homo sapiens |
Alignment Length: | 204 | Identity: | 46/204 - (22%) |
---|---|---|---|
Similarity: | 81/204 - (39%) | Gaps: | 35/204 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 4800 MHNELEEPPEPEEMDLGDMNNVDEGHDDQDEQPTDENPFDIDAMKENMQPAEEPEADGDDEHDAN 4864
Fly 4865 EEGDPQSDGSDSEEDEAGTEAKPAEEDHGEGEEATPEDEKDEAETQKRGELEDEDDSKPEDSPED 4929
Fly 4930 SKEEKEEKRE--EKPEEHS---QSKDKASK---------EENVQSM--PETDQSSSADQVQQPQD 4978
Fly 4979 PDIKQDQKL 4987 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG13185 | NP_001097279.2 | MDN1 | 298..5521 | CDD:227596 | 46/204 (23%) |
P-loop_NTPase | 315..505 | CDD:304359 | |||
P-loop_NTPase | <887..972 | CDD:304359 | |||
P-loop_NTPase | 1147..1283 | CDD:304359 | |||
P-loop_NTPase | 1454..1603 | CDD:304359 | |||
P-loop_NTPase | 1795..1946 | CDD:304359 | |||
P-loop_NTPase | <2335..>2378 | CDD:304359 | |||
Prothymosin | 4843..4920 | CDD:281265 | 16/76 (21%) | ||
PHA03151 | 4856..5060 | CDD:177546 | 34/148 (23%) | ||
MttA_Hcf106 | <5046..5166 | CDD:294511 | |||
vWA_midasin | 5261..5526 | CDD:238737 | |||
TCEAL2 | NP_525129.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..145 | 36/159 (23%) | |
BEX | <123..202 | CDD:282406 | 15/66 (23%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 202..227 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |