DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13185 and AgaP_AGAP007473

DIOPT Version :9

Sequence 1:NP_001097279.2 Gene:CG13185 / 36268 FlyBaseID:FBgn0033661 Length:5526 Species:Drosophila melanogaster
Sequence 2:XP_308400.4 Gene:AgaP_AGAP007473 / 1269751 VectorBaseID:AGAP007473 Length:372 Species:Anopheles gambiae


Alignment Length:238 Identity:59/238 - (24%)
Similarity:102/238 - (42%) Gaps:53/238 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly  4810 PEEMDLGDMNNVDEGHDDQDEQPTDENPFDIDAMKENMQPAEEPEADGDDEHDANEE-------- 4866
            |:|||:.||.:.:|    .||:..||...|:            |.|:|:.:....:|        
Mosquito    90 PDEMDMEDMGDEEE----DDEELEDEEEEDV------------PAANGNSKARTAKEVAKAKVAK 138

  Fly  4867 ---GDPQSDGSDSEE--------DEAGTEAKPAEEDHGEGEEATPEDEKDEAETQKRGELEDEDD 4920
               ....|:|||:|:        |::.. ...||:|..:.:|...:|..|:.:.:  .|.||:||
Mosquito   139 KIAAGEVSEGSDAEDTTFSESMHDDSAI-VNGAEDDDDDDDEEDDDDSDDDEDVE--DEEEDDDD 200

  Fly  4921 SKPEDSPEDSKEEKEEKREEKPEEHSQSK----DKASKEENVQSMPETDQSSSADQ----VQQPQ 4977
            ...||..||..||.||..:.|..:..|:|    .||:...|.::..|..:.....|    ::..|
Mosquito   201 DDEEDDDEDDDEEDEEDEDVKQPKAKQAKLANDGKAAVNGNAKAAKEAPKKQEQQQKKGGMRTLQ 265

  Fly  4978 DPDIKQDQKL---DEQETGEE----KDGVGQAENDADDGGHQG 5013
            |..:.:|.|:   .|.:.|::    .:|..::.|...|..::|
Mosquito   266 DGLMVEDLKVGNGPEAKPGKKIAVYYEGRLKSNNKVFDSTNKG 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13185NP_001097279.2 MDN1 298..5521 CDD:227596 59/238 (25%)
P-loop_NTPase 315..505 CDD:304359
P-loop_NTPase <887..972 CDD:304359
P-loop_NTPase 1147..1283 CDD:304359
P-loop_NTPase 1454..1603 CDD:304359
P-loop_NTPase 1795..1946 CDD:304359
P-loop_NTPase <2335..>2378 CDD:304359
Prothymosin 4843..4920 CDD:281265 19/95 (20%)
PHA03151 4856..5060 CDD:177546 45/192 (23%)
MttA_Hcf106 <5046..5166 CDD:294511
vWA_midasin 5261..5526 CDD:238737
AgaP_AGAP007473XP_308400.4 FKBP_C 280..369 CDD:278674 6/29 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.