powered by:
Protein Alignment CG13185 and LOC100498329
DIOPT Version :9
Sequence 1: | NP_001097279.2 |
Gene: | CG13185 / 36268 |
FlyBaseID: | FBgn0033661 |
Length: | 5526 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_002941396.1 |
Gene: | LOC100498329 / 100498329 |
-ID: | - |
Length: | 126 |
Species: | Xenopus tropicalis |
Alignment Length: | 53 |
Identity: | 15/53 - (28%) |
Similarity: | 25/53 - (47%) |
Gaps: | 3/53 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 5325 IAIDDSKSMHHNNSKTLTLEAISLVSQALTLLESGRLSIVSFGEAPQIILNHT 5377
||.:.|:..|:|...|:|...| ..|:.||..|.|:..:..|..:.:..:|
Frog 74 IAGEASRLAHYNKRSTITSREI---QTAVRLLLPGELAKHAVSEGTKAVTKYT 123
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.