DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tp73 and p53

DIOPT Version :9

Sequence 1:NP_001102166.1 Gene:Tp73 / 362675 RGDID:1307083 Length:684 Species:Rattus norvegicus
Sequence 2:NP_996267.1 Gene:p53 / 2768677 FlyBaseID:FBgn0039044 Length:495 Species:Drosophila melanogaster


Alignment Length:459 Identity:103/459 - (22%)
Similarity:170/459 - (37%) Gaps:79/459 - (17%)


- Green bases have known domain annotations that are detailed below.


  Rat    23 APLPKSTDP----SRAQVQPRMSNGVGEMAQSSSSSSSS----STFE-HLWSSLEPDSTYFDLPQ 78
            |.|....||    :......:.:|.:..:|.::|..::.    :.|. |..:..|.|||..|:.:
  Fly    73 AHLATPVDPAYGGNNTNNMMQFTNNLEILANNNSDGNNKINACNKFVCHKGTDSEDDSTEVDIKE 137

  Rat    79 PSQGNSEATGSEESNMDVFHLQGMTSSVMAQFNLLSSAMDQMGSRAAPASPYTPEHAASAPTHSP 143
            ......|.:|||.:...:..|||:.|..:.||:..|...:.|                       
  Fly   138 DIPKTVEVSGSELTTEPMAFLQGLNSGNLMQFSQQSVLREMM----------------------- 179

  Rat   144 YAQPSSTFDTMSPAPVIPSNTDYP-GPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAK--TCP 205
                  ..|....|..:|...::. |.:.|.:...:   ...:.|.||..|.|||.::.|  ...
  Fly   180 ------LQDIQIQANTLPKLENHNIGGYCFSMVLDE---PPKSLWMYSIPLNKLYIRMNKAFNVD 235

  Rat   206 IQIKVSTPPPPGTAIRAMPVYKKAEHVTDIVKRCPNHELGRDFNEGQSAPASHLIRVEGNNLSQY 270
            :|.|...|..| ..:|....:  :..|:..|.||.||..........:.....|:|.|..| |.|
  Fly   236 VQFKSKMPIQP-LNLRVFLCF--SNDVSAPVVRCQNHLSVEPLTANNAKMRESLLRSENPN-SVY 296

  Rat   271 VDDP----VTGRQSVVVPY----EPPQVGTEFTTILYNFMCNSSCVGGMNRRPILVIITLETRDG 327
            ..:.    ::.|.|||||.    ...:.|....|:.:.|:|.:||:|   |:...::..||...|
  Fly   297 CGNAQGKGISERFSVVVPLNMSRSVTRSGLTRQTLAFKFVCQNSCIG---RKETSLVFCLEKACG 358

  Rat   328 QVLGRRSFEGRICACPGRDRKADEDHYREQQALNESTTKNGAASKRAFKQSPP------AIPALG 386
            .::|:.....:||.||.|||..||      :.||  :.|..:..:.|.:..|.      ||....
  Fly   359 DIVGQHVIHVKICTCPKRDRIQDE------RQLN--SKKRKSVPEAAEEDEPSKVRRCIAIKTED 415

  Rat   387 TNVKKRRHGDEDMFYMHVR----GRENFEILMKVKESL--ELMELVPQPLVDSYRQQQQQQLLQR 445
            |.....|..|:.....:|.    |.....|....||.|  .:..::.:...:..|...|:.|.:.
  Fly   416 TESNDSRDCDDSAAEWNVSRTPDGDYRLAITCPNKEWLLQSIEGMIKEAAAEVLRNPNQENLRRH 480

  Rat   446 PSHL 449
            .:.|
  Fly   481 ANKL 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tp73NP_001102166.1 P53 158..354 CDD:279242 55/206 (27%)
P53_tetramer 390..429 CDD:285011 8/44 (18%)
SAM_tumor-p73 534..598 CDD:188970
SAM 538..598 CDD:197735
Gp37 593..>683 CDD:286696
p53NP_996267.1 P53 203..383 CDD:176262 53/195 (27%)
P53_C 429..495 CDD:288471 10/56 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340687
Domainoid 1 1.000 65 1.000 Domainoid score I9777
eggNOG 1 0.900 - - E1_2C1DX
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm45413
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11447
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.800

Return to query results.
Submit another query.