DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Damm and CFLAR

DIOPT Version :9

Sequence 1:NP_001303345.1 Gene:Damm / 36266 FlyBaseID:FBgn0033659 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001120655.1 Gene:CFLAR / 8837 HGNCID:1876 Length:480 Species:Homo sapiens


Alignment Length:179 Identity:38/179 - (21%)
Similarity:67/179 - (37%) Gaps:42/179 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 NDVNALRKTFESLKCRVEVISNPALPDVKNKVKEWSAKRFTQD-AGFVLFILSHG--------DR 116
            |:...||.||.||...|:...:.::..:...:.:::.....:| ..||..::|.|        |:
Human   262 NETELLRDTFTSLGYEVQKFLHLSMHGISQILGQFACMPEHRDYDSFVCVLVSRGGSQSVYGVDQ 326

  Fly   117 KEKILACDH-REYHLDDDVLFPLFRNPTLSGKPKILIVQ---ACKGP------LRADAKKMNNEP 171
            ....|...| |...:.|..       |.|:||||:..:|   ..:|.      |..|...|.|..
Human   327 THSGLPLHHIRRMFMGDSC-------PYLAGKPKMFFIQNYVVSEGQLEDSSLLEVDGPAMKNVE 384

  Fly   172 YIK-----C---------YSCSEGYLSYRNENHG--SVFIQTLCEAMDQ 204
            :..     |         :|.....:|...::|.  |:::|.|.:.:.|
Human   385 FKAQKRGLCTVHREADFFWSLCTADMSLLEQSHSSPSLYLQCLSQKLRQ 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DammNP_001303345.1 Peptidase_C14 42..248 CDD:279049 38/179 (21%)
CFLARNP_001120655.1 Not proteolytically processed and involved in apoptosis inhibition 1..435 38/179 (21%)
Interaction with CASP8 propeptide. /evidence=ECO:0000269|PubMed:9208847, ECO:0000269|PubMed:9326610 1..305 8/42 (19%)
Interaction with FADD. /evidence=ECO:0000269|PubMed:9208847, ECO:0000269|PubMed:9326610 1..227
Interaction with CASP8. /evidence=ECO:0000269|PubMed:9208847, ECO:0000269|PubMed:9326610 1..195
DED_c-FLIP_r1 1..80 CDD:260044
DED_c-FLIP_r2 91..171 CDD:260046
Interaction with TRAF1 and TRAF2. /evidence=ECO:0000269|PubMed:9208847 192..480 38/179 (21%)
Interaction with CASP3. /evidence=ECO:0000269|PubMed:9208847, ECO:0000269|PubMed:9326610 192..435 38/179 (21%)
Interaction with CASP8 subunits p18 and p10. /evidence=ECO:0000269|PubMed:9208847, ECO:0000269|PubMed:9326610 217..480 38/179 (21%)
CASc 244..479 CDD:214521 38/179 (21%)
Caspase 263..358 23/101 (23%)
Interaction with CASP8. /evidence=ECO:0000269|PubMed:9208847, ECO:0000269|PubMed:9326610 370..480 12/64 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.