DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Damm and CASP10

DIOPT Version :9

Sequence 1:NP_001303345.1 Gene:Damm / 36266 FlyBaseID:FBgn0033659 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_116759.2 Gene:CASP10 / 843 HGNCID:1500 Length:522 Species:Homo sapiens


Alignment Length:299 Identity:69/299 - (23%)
Similarity:112/299 - (37%) Gaps:65/299 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LPERTEHQKIERLYDSNRVNAEPG------QGLDLN-----EKLKPPAVY-----------ILNH 45
            ||:.:...|......:...|..|.      ||...|     ...|..|||           |:|:
Human   227 LPQESWQNKHAGSNGNRATNGAPSLVSRGMQGASANTLNSETSTKRAAVYRMNRNHRGLCVIVNN 291

  Fly    46 EQFPQDSQLNRKGSSNDVNALRKTFESLKCRVEVISNPALPDVKNKVKEWSAKRFTQDAG-FVLF 109
            ..|  .|..:|:|:..|...|...|:.|...|.:.:|....:::..:::........|.. ||..
Human   292 HSF--TSLKDRQGTHKDAEILSHVFQWLGFTVHIHNNVTKVEMEMVLQKQKCNPAHADGDCFVFC 354

  Fly   110 ILSHGDRKEKILACDHREYHLDDDVLFPL---------FRNPTLSGKPKILIVQACKG------- 158
            ||:||         .....:..|:.|.|:         .:.|.|:.|||:..:|||:|       
Human   355 ILTHG---------RFGAVYSSDEALIPIREIMSHFTALQCPRLAEKPKLFFIQACQGEEIQPSV 410

  Fly   159 PLRADAKKMNNEP------------YIKCYSCSEGYLSYRNENHGSVFIQTLCEAMDQYGLTR-- 209
            .:.|||......|            ::...:...||:|:|:...||.:||:||..:.:. :.|  
Human   411 SIEADALNPEQAPTSLQDSIPAEADFLLGLATVPGYVSFRHVEEGSWYIQSLCNHLKKL-VPRHE 474

  Fly   210 DFQSIFKHVKAEVERRSTMTGSKQVPSEESHNFDKPFYF 248
            |..||...|..:|.||....|:|:...:.:....|...|
Human   475 DILSILTAVNDDVSRRVDKQGTKKQMPQPAFTLRKKLVF 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DammNP_001303345.1 Peptidase_C14 42..248 CDD:279049 56/236 (24%)
CASP10NP_116759.2 DD 18..99 CDD:326335
DED_Caspase_10_r2 112..190 CDD:260074
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 231..269 6/37 (16%)
CASc 276..514 CDD:214521 58/250 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.