DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Damm and CASP8

DIOPT Version :9

Sequence 1:NP_001303345.1 Gene:Damm / 36266 FlyBaseID:FBgn0033659 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001073594.1 Gene:CASP8 / 841 HGNCID:1509 Length:538 Species:Homo sapiens


Alignment Length:261 Identity:71/261 - (27%)
Similarity:112/261 - (42%) Gaps:48/261 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 DSNRVNAEPGQGLDLNEKLK-PPAVYIL---NH------EQFPQ-DSQLNRKGSSNDVNALRKTF 70
            ||.|......|.||...::| .|..|.|   ||      |:.|: .|..:|.|:..|..||..||
Human   269 DSPREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTF 333

  Fly    71 ESLKCRVEVISNPALPDVKNKVKEWSAKRFTQDAGFVLFILSHGDRKEKILACDHRE---YHLDD 132
            |.|...::...:..:..:...:|.:.....:....|:..|||||| |..|...|.:|   |.|..
Human   334 EELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGD-KGIIYGTDGQEAPIYELTS 397

  Fly   133 DVLFPLFRNPTLSGKPKILIVQACKG-------PLRADAKKMNNEPYIKCYSCS----------- 179
            .  |...:.|:|:||||:..:|||:|       |:..|:::   :||::....|           
Human   398 Q--FTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDSEE---QPYLEMDLSSPQTRYIPDEAD 457

  Fly   180 --------EGYLSYRNENHGSVFIQTLCEAM-DQYGLTRDFQSIFKHVKAEVERRSTMTG-SKQV 234
                    ...:||||...|:.:||:||::: ::.....|..:|...|..||..:..... .||:
Human   458 FLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQM 522

  Fly   235 P 235
            |
Human   523 P 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DammNP_001303345.1 Peptidase_C14 42..248 CDD:279049 62/235 (26%)
CASP8NP_001073594.1 DED_Caspase_8_r1 62..143 CDD:260041
DD 157..239 CDD:301326
CASc 284..536 CDD:237997 65/246 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.